Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SEV5

Protein Details
Accession A0A1E4SEV5    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-46QNLHRVPPPRRYKTSKQLFTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MSQTPETQSIDLQDLSVITTRPHTFKQNLHRVPPPRRYKTSKQLFTDEQKYLQTKDIKFDTPTWQSIGAPPSLKPNKHYCDITGLEGRYKNPSNGLRFHNVEIYQEVIRNMPPGVDQEYLKLRGANVVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.11
5 0.09
6 0.14
7 0.16
8 0.2
9 0.23
10 0.28
11 0.32
12 0.39
13 0.49
14 0.55
15 0.58
16 0.6
17 0.64
18 0.67
19 0.71
20 0.73
21 0.73
22 0.7
23 0.73
24 0.76
25 0.77
26 0.78
27 0.8
28 0.78
29 0.72
30 0.7
31 0.68
32 0.66
33 0.63
34 0.53
35 0.44
36 0.39
37 0.37
38 0.32
39 0.33
40 0.32
41 0.27
42 0.3
43 0.31
44 0.29
45 0.29
46 0.3
47 0.3
48 0.27
49 0.28
50 0.24
51 0.22
52 0.2
53 0.21
54 0.2
55 0.15
56 0.13
57 0.12
58 0.21
59 0.25
60 0.25
61 0.27
62 0.33
63 0.36
64 0.39
65 0.4
66 0.31
67 0.33
68 0.34
69 0.34
70 0.3
71 0.26
72 0.26
73 0.26
74 0.26
75 0.26
76 0.26
77 0.23
78 0.26
79 0.32
80 0.32
81 0.37
82 0.4
83 0.41
84 0.41
85 0.42
86 0.41
87 0.35
88 0.32
89 0.28
90 0.26
91 0.21
92 0.2
93 0.19
94 0.15
95 0.15
96 0.15
97 0.13
98 0.11
99 0.11
100 0.12
101 0.16
102 0.17
103 0.17
104 0.2
105 0.26
106 0.28
107 0.28
108 0.27
109 0.23
110 0.25