Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SL55

Protein Details
Accession A0A1E4SL55    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-40AALAGGKKGKKKWNKGKVKDKAQHAIHydrophilic
NLS Segment(s)
PositionSequence
13-35AAAALAGGKKGKKKWNKGKVKDK
Subcellular Location(s) cyto 17, cyto_nucl 11.333, mito 6.5, mito_nucl 5.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPKVQQTKAAKAAAALAGGKKGKKKWNKGKVKDKAQHAITLDQEKYDRILKDVPGYKFVSVSVLVDRLKIGGSLARVALRQLEEDGIITPILKHSKQSIYTRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.2
4 0.13
5 0.16
6 0.19
7 0.21
8 0.23
9 0.29
10 0.37
11 0.46
12 0.56
13 0.63
14 0.71
15 0.8
16 0.85
17 0.9
18 0.9
19 0.91
20 0.87
21 0.83
22 0.8
23 0.7
24 0.64
25 0.55
26 0.47
27 0.39
28 0.37
29 0.3
30 0.23
31 0.21
32 0.18
33 0.18
34 0.19
35 0.16
36 0.13
37 0.15
38 0.15
39 0.21
40 0.26
41 0.25
42 0.25
43 0.26
44 0.25
45 0.23
46 0.22
47 0.18
48 0.12
49 0.12
50 0.09
51 0.11
52 0.11
53 0.11
54 0.11
55 0.09
56 0.09
57 0.08
58 0.08
59 0.07
60 0.08
61 0.09
62 0.1
63 0.1
64 0.1
65 0.11
66 0.13
67 0.12
68 0.12
69 0.12
70 0.12
71 0.11
72 0.11
73 0.12
74 0.1
75 0.09
76 0.08
77 0.08
78 0.12
79 0.16
80 0.16
81 0.18
82 0.23
83 0.3
84 0.38