Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SSI3

Protein Details
Accession A0A1E4SSI3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27IEQACDSCRKRKLKCSKEYPRCSKCIHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences IEQACDSCRKRKLKCSKEYPRCSKCIHHSWCCYYSPRTVRSPLTRAHLTQVENK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.86
4 0.88
5 0.92
6 0.92
7 0.86
8 0.8
9 0.73
10 0.68
11 0.65
12 0.64
13 0.6
14 0.57
15 0.56
16 0.56
17 0.56
18 0.52
19 0.47
20 0.4
21 0.41
22 0.4
23 0.4
24 0.39
25 0.41
26 0.46
27 0.5
28 0.51
29 0.47
30 0.49
31 0.48
32 0.45
33 0.47
34 0.45