Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z9G6

Protein Details
Accession C7Z9G6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPSRNHQTTPRRIKFRKTANDIQRKIKVHydrophilic
NLS Segment(s)
PositionSequence
163-165KKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016665  Sas5/TAF14  
IPR038704  YEAST_sf  
IPR005033  YEATS  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0016514  C:SWI/SNF complex  
GO:0005669  C:transcription factor TFIID complex  
GO:0005674  C:transcription factor TFIIF complex  
GO:0006338  P:chromatin remodeling  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG nhe:NECHADRAFT_44228  -  
Pfam View protein in Pfam  
PF03366  YEATS  
PROSITE View protein in PROSITE  
PS51037  YEATS  
CDD cd16905  YEATS_Taf14_like  
Amino Acid Sequences MPSRNHQTTPRRIKFRKTANDIQRKIKVVTEQHVIDKPSPMEAFPMREWSLKIFLLDEDGNERPADVFNKVVYNLHPTFENPVQTFTKAPFTCQNEGWGEFEISIDCYTTEKTKLAPIIQDLNFQKNKYDVTHTVVFKNPSQNLQERLRETGPLPTDDDHRPKKKGLATKKSAQKYDYEKIAEALEKLEEEDLLRVIQLINENKGPDTYIRSDVEVDDLTKAGEFSIDLYTMPDILTTKLWDHLSKKGLVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.84
4 0.81
5 0.82
6 0.82
7 0.88
8 0.84
9 0.83
10 0.79
11 0.72
12 0.64
13 0.58
14 0.55
15 0.49
16 0.49
17 0.47
18 0.42
19 0.43
20 0.46
21 0.44
22 0.38
23 0.36
24 0.32
25 0.3
26 0.28
27 0.23
28 0.24
29 0.24
30 0.27
31 0.24
32 0.29
33 0.26
34 0.28
35 0.28
36 0.26
37 0.28
38 0.23
39 0.23
40 0.17
41 0.16
42 0.18
43 0.17
44 0.15
45 0.15
46 0.15
47 0.16
48 0.14
49 0.14
50 0.11
51 0.13
52 0.14
53 0.11
54 0.12
55 0.12
56 0.14
57 0.14
58 0.15
59 0.14
60 0.2
61 0.19
62 0.19
63 0.18
64 0.17
65 0.22
66 0.23
67 0.27
68 0.2
69 0.23
70 0.24
71 0.24
72 0.25
73 0.2
74 0.27
75 0.23
76 0.25
77 0.28
78 0.32
79 0.34
80 0.34
81 0.36
82 0.29
83 0.3
84 0.29
85 0.22
86 0.17
87 0.14
88 0.14
89 0.1
90 0.09
91 0.08
92 0.06
93 0.05
94 0.06
95 0.07
96 0.08
97 0.09
98 0.09
99 0.1
100 0.12
101 0.14
102 0.14
103 0.14
104 0.15
105 0.2
106 0.2
107 0.25
108 0.24
109 0.28
110 0.29
111 0.28
112 0.26
113 0.21
114 0.22
115 0.18
116 0.22
117 0.17
118 0.21
119 0.27
120 0.27
121 0.28
122 0.29
123 0.3
124 0.27
125 0.3
126 0.26
127 0.23
128 0.26
129 0.27
130 0.3
131 0.33
132 0.36
133 0.32
134 0.35
135 0.32
136 0.3
137 0.27
138 0.27
139 0.24
140 0.2
141 0.2
142 0.18
143 0.21
144 0.25
145 0.32
146 0.35
147 0.39
148 0.4
149 0.4
150 0.45
151 0.47
152 0.52
153 0.54
154 0.56
155 0.58
156 0.64
157 0.71
158 0.71
159 0.68
160 0.6
161 0.56
162 0.54
163 0.52
164 0.49
165 0.43
166 0.37
167 0.34
168 0.35
169 0.29
170 0.22
171 0.17
172 0.12
173 0.1
174 0.1
175 0.09
176 0.08
177 0.07
178 0.08
179 0.07
180 0.07
181 0.07
182 0.06
183 0.06
184 0.08
185 0.13
186 0.15
187 0.17
188 0.19
189 0.2
190 0.2
191 0.21
192 0.21
193 0.16
194 0.2
195 0.21
196 0.24
197 0.24
198 0.25
199 0.26
200 0.25
201 0.26
202 0.22
203 0.19
204 0.14
205 0.13
206 0.12
207 0.11
208 0.11
209 0.08
210 0.07
211 0.06
212 0.07
213 0.09
214 0.09
215 0.09
216 0.1
217 0.11
218 0.1
219 0.1
220 0.1
221 0.09
222 0.1
223 0.12
224 0.13
225 0.14
226 0.19
227 0.22
228 0.26
229 0.28
230 0.34
231 0.38