Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SSA9

Protein Details
Accession A0A1E4SSA9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
173-195EIPATPPPKKKKVRRDTPATPASHydrophilic
NLS Segment(s)
PositionSequence
180-186PKKKKVR
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007526  SWIRM  
IPR036388  WH-like_DNA-bd_sf  
Pfam View protein in Pfam  
PF04433  SWIRM  
PROSITE View protein in PROSITE  
PS50934  SWIRM  
Amino Acid Sequences MSLLYQPLSRSARDISGCLTPVQADDNELGTSMSRGHAYTKRPVQQPKGLSVSNILSPPLSPYQRAAVVSHPPLVIDDKSYLESKSPFTIENYKDYKLTIHPWTNLQSNYKASHLHFINQYHHMSAAEPERSVPRRFKRRLVQENSDDNSSDQERVRTRRVARSKDLDSELDEIPATPPPKKKKVRRDTPATPASVALQQQMLMDDSIPDYSPDASATLPANNSKCLKIEWKGQPMDLSSDPNLSKLHPAEVVLASILRLPVLVYLDSKRRLFHEKLQRVRSGRQFRRTDAQKACRIDVNKASRLFAAFEKVGWLNDAHFEKYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.27
3 0.29
4 0.29
5 0.26
6 0.24
7 0.18
8 0.17
9 0.19
10 0.17
11 0.14
12 0.14
13 0.15
14 0.14
15 0.14
16 0.13
17 0.1
18 0.11
19 0.1
20 0.1
21 0.09
22 0.1
23 0.16
24 0.21
25 0.26
26 0.35
27 0.43
28 0.49
29 0.56
30 0.64
31 0.66
32 0.69
33 0.68
34 0.66
35 0.63
36 0.55
37 0.48
38 0.43
39 0.37
40 0.32
41 0.28
42 0.22
43 0.16
44 0.15
45 0.19
46 0.22
47 0.22
48 0.2
49 0.21
50 0.24
51 0.27
52 0.28
53 0.26
54 0.23
55 0.28
56 0.29
57 0.29
58 0.25
59 0.22
60 0.22
61 0.24
62 0.2
63 0.15
64 0.15
65 0.14
66 0.16
67 0.17
68 0.16
69 0.16
70 0.17
71 0.17
72 0.19
73 0.19
74 0.17
75 0.2
76 0.28
77 0.28
78 0.34
79 0.35
80 0.34
81 0.33
82 0.32
83 0.31
84 0.25
85 0.28
86 0.28
87 0.29
88 0.29
89 0.32
90 0.35
91 0.37
92 0.36
93 0.34
94 0.3
95 0.29
96 0.29
97 0.27
98 0.27
99 0.24
100 0.28
101 0.26
102 0.26
103 0.27
104 0.29
105 0.31
106 0.32
107 0.32
108 0.25
109 0.24
110 0.21
111 0.17
112 0.17
113 0.17
114 0.14
115 0.13
116 0.14
117 0.19
118 0.23
119 0.25
120 0.31
121 0.36
122 0.45
123 0.5
124 0.57
125 0.6
126 0.68
127 0.75
128 0.74
129 0.72
130 0.69
131 0.72
132 0.65
133 0.57
134 0.47
135 0.36
136 0.31
137 0.25
138 0.2
139 0.13
140 0.16
141 0.19
142 0.22
143 0.26
144 0.3
145 0.32
146 0.4
147 0.47
148 0.49
149 0.5
150 0.53
151 0.51
152 0.49
153 0.48
154 0.39
155 0.33
156 0.3
157 0.25
158 0.19
159 0.16
160 0.12
161 0.1
162 0.13
163 0.12
164 0.13
165 0.19
166 0.26
167 0.36
168 0.45
169 0.54
170 0.62
171 0.72
172 0.79
173 0.82
174 0.84
175 0.81
176 0.81
177 0.76
178 0.66
179 0.55
180 0.45
181 0.37
182 0.3
183 0.24
184 0.16
185 0.11
186 0.1
187 0.1
188 0.1
189 0.09
190 0.07
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.07
200 0.07
201 0.07
202 0.06
203 0.08
204 0.09
205 0.1
206 0.1
207 0.14
208 0.15
209 0.18
210 0.2
211 0.19
212 0.19
213 0.2
214 0.24
215 0.25
216 0.33
217 0.37
218 0.44
219 0.44
220 0.44
221 0.43
222 0.39
223 0.4
224 0.32
225 0.27
226 0.2
227 0.23
228 0.22
229 0.22
230 0.22
231 0.18
232 0.21
233 0.19
234 0.2
235 0.16
236 0.17
237 0.18
238 0.18
239 0.18
240 0.13
241 0.12
242 0.1
243 0.1
244 0.09
245 0.06
246 0.05
247 0.05
248 0.06
249 0.08
250 0.09
251 0.1
252 0.14
253 0.21
254 0.26
255 0.27
256 0.27
257 0.29
258 0.36
259 0.39
260 0.45
261 0.5
262 0.55
263 0.64
264 0.69
265 0.72
266 0.69
267 0.73
268 0.73
269 0.73
270 0.72
271 0.73
272 0.72
273 0.69
274 0.75
275 0.73
276 0.73
277 0.72
278 0.72
279 0.7
280 0.69
281 0.67
282 0.63
283 0.59
284 0.56
285 0.55
286 0.54
287 0.53
288 0.51
289 0.49
290 0.44
291 0.43
292 0.39
293 0.32
294 0.3
295 0.23
296 0.22
297 0.24
298 0.24
299 0.23
300 0.22
301 0.2
302 0.15
303 0.22
304 0.24