Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3BFG2

Protein Details
Accession G3BFG2   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
41-60DPKLEEFKKNREKQFLKRATHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 7, cyto 6.5, cyto_nucl 6, E.R. 5, nucl 4.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008568  EMC3  
IPR002809  EMC3/TMCO1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
KEGG cten:CANTEDRAFT_116743  -  
Pfam View protein in Pfam  
PF01956  EMC3_TMCO1  
Amino Acid Sequences MVPDELVLDPQLKYWVLLPISVVMVVVGLLRSNVTLLLKSDPKLEEFKKNREKQFLKRATSFKNGSSVLTRDEFLVRQEYFITQLKSSEFFANKNVSSDAPANPLTDPGSADALMEMAKGNMMNYIPQTLIMAWVNYFFAGFVIMKLPFPITDSFKSMLQQGIVTPDLNVRYVSSISWYFVNLMGLKPVYSLIMNDSSAADELVNSQQQNQQLPNLGAPGAPKVDKIFEKEAADIQILSHESIYDGIIDRVLAADL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.18
4 0.18
5 0.18
6 0.17
7 0.17
8 0.16
9 0.14
10 0.08
11 0.07
12 0.07
13 0.06
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.07
21 0.07
22 0.08
23 0.1
24 0.15
25 0.18
26 0.19
27 0.24
28 0.23
29 0.25
30 0.32
31 0.34
32 0.39
33 0.43
34 0.53
35 0.59
36 0.66
37 0.7
38 0.74
39 0.77
40 0.76
41 0.8
42 0.79
43 0.75
44 0.74
45 0.73
46 0.69
47 0.7
48 0.63
49 0.53
50 0.5
51 0.44
52 0.38
53 0.35
54 0.31
55 0.26
56 0.24
57 0.23
58 0.18
59 0.19
60 0.18
61 0.16
62 0.2
63 0.16
64 0.15
65 0.16
66 0.15
67 0.17
68 0.2
69 0.21
70 0.16
71 0.17
72 0.17
73 0.18
74 0.2
75 0.21
76 0.18
77 0.17
78 0.21
79 0.23
80 0.22
81 0.23
82 0.21
83 0.17
84 0.18
85 0.19
86 0.16
87 0.16
88 0.16
89 0.16
90 0.15
91 0.15
92 0.14
93 0.12
94 0.11
95 0.09
96 0.09
97 0.08
98 0.08
99 0.07
100 0.06
101 0.06
102 0.05
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.04
109 0.04
110 0.05
111 0.05
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.07
118 0.07
119 0.06
120 0.05
121 0.06
122 0.06
123 0.05
124 0.05
125 0.04
126 0.03
127 0.04
128 0.04
129 0.04
130 0.06
131 0.06
132 0.06
133 0.07
134 0.07
135 0.06
136 0.08
137 0.1
138 0.13
139 0.14
140 0.17
141 0.19
142 0.19
143 0.2
144 0.19
145 0.18
146 0.14
147 0.12
148 0.1
149 0.11
150 0.11
151 0.11
152 0.1
153 0.11
154 0.11
155 0.12
156 0.11
157 0.09
158 0.1
159 0.1
160 0.1
161 0.11
162 0.11
163 0.11
164 0.12
165 0.12
166 0.11
167 0.11
168 0.14
169 0.11
170 0.1
171 0.11
172 0.11
173 0.1
174 0.1
175 0.09
176 0.08
177 0.08
178 0.08
179 0.09
180 0.11
181 0.11
182 0.12
183 0.12
184 0.11
185 0.11
186 0.11
187 0.08
188 0.06
189 0.08
190 0.1
191 0.13
192 0.12
193 0.14
194 0.17
195 0.2
196 0.24
197 0.23
198 0.23
199 0.25
200 0.26
201 0.25
202 0.22
203 0.19
204 0.17
205 0.16
206 0.16
207 0.15
208 0.14
209 0.14
210 0.15
211 0.21
212 0.23
213 0.28
214 0.3
215 0.32
216 0.34
217 0.34
218 0.35
219 0.32
220 0.3
221 0.24
222 0.19
223 0.18
224 0.17
225 0.16
226 0.13
227 0.11
228 0.11
229 0.12
230 0.12
231 0.09
232 0.09
233 0.09
234 0.09
235 0.09
236 0.09