Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SGH2

Protein Details
Accession A0A1E4SGH2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
82-115MDSVLRKRRLKMKKHKLRKRRREQRSLMKRLGKIBasic
NLS Segment(s)
PositionSequence
87-115RKRRLKMKKHKLRKRRREQRSLMKRLGKI
Subcellular Location(s) mito 23, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFGARTMMQRLPFTALRMLSSVARVPRFTAAPLAARLFPSSVTVTTPHTMVSHIQPELSILDKLPMNAFEEPVVEEDKTMYMDSVLRKRRLKMKKHKLRKRRREQRSLMKRLGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.24
4 0.23
5 0.23
6 0.18
7 0.19
8 0.2
9 0.2
10 0.22
11 0.21
12 0.21
13 0.23
14 0.23
15 0.21
16 0.21
17 0.18
18 0.18
19 0.2
20 0.2
21 0.18
22 0.18
23 0.17
24 0.14
25 0.13
26 0.13
27 0.12
28 0.1
29 0.11
30 0.11
31 0.13
32 0.14
33 0.14
34 0.12
35 0.11
36 0.11
37 0.11
38 0.13
39 0.13
40 0.12
41 0.12
42 0.11
43 0.11
44 0.11
45 0.11
46 0.09
47 0.06
48 0.07
49 0.08
50 0.08
51 0.08
52 0.08
53 0.1
54 0.1
55 0.1
56 0.09
57 0.09
58 0.09
59 0.1
60 0.11
61 0.08
62 0.08
63 0.08
64 0.08
65 0.09
66 0.08
67 0.07
68 0.06
69 0.09
70 0.14
71 0.22
72 0.29
73 0.35
74 0.39
75 0.44
76 0.54
77 0.61
78 0.67
79 0.7
80 0.74
81 0.78
82 0.86
83 0.92
84 0.93
85 0.95
86 0.95
87 0.96
88 0.95
89 0.95
90 0.95
91 0.94
92 0.95
93 0.94
94 0.93
95 0.9