Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SR82

Protein Details
Accession A0A1E4SR82    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKSSAKPQKKIKQKLDITFTCHydrophilic
NLS Segment(s)
PositionSequence
3-15KRKSSAKPQKKIK
Subcellular Location(s) mito 8.5, cyto_nucl 8.333, cyto_mito 8.166, nucl 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSAKPQKKIKQKLDITFTCLFCNHEKSVICTLDKKNLLGELHCKICGQSFQSAIHSLSQPIDIYSDWIDACEDLAEEADKNGGAGGEADEYSDDEFDRPKAVKAPDSEDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.87
4 0.85
5 0.83
6 0.75
7 0.71
8 0.66
9 0.57
10 0.48
11 0.4
12 0.35
13 0.29
14 0.32
15 0.26
16 0.25
17 0.25
18 0.28
19 0.33
20 0.33
21 0.31
22 0.32
23 0.33
24 0.36
25 0.37
26 0.32
27 0.27
28 0.28
29 0.27
30 0.23
31 0.25
32 0.2
33 0.2
34 0.2
35 0.19
36 0.16
37 0.16
38 0.17
39 0.15
40 0.13
41 0.14
42 0.14
43 0.16
44 0.17
45 0.16
46 0.16
47 0.14
48 0.12
49 0.11
50 0.1
51 0.09
52 0.08
53 0.08
54 0.07
55 0.08
56 0.08
57 0.09
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.05
64 0.05
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.05
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.08
85 0.07
86 0.07
87 0.09
88 0.09
89 0.13
90 0.14
91 0.15
92 0.22
93 0.25
94 0.3
95 0.33
96 0.4