Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZIG7

Protein Details
Accession C7ZIG7   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
162-185RGGGEKRQDKKGKQRQRGDGNGDDBasic
NLS Segment(s)
PositionSequence
161-177HRGGGEKRQDKKGKQRQ
Subcellular Location(s) extr 7, mito 6, nucl 3, cyto 3, cyto_nucl 3, E.R. 3, golg 3
Family & Domain DBs
KEGG nhe:NECHADRAFT_87136  -  
Amino Acid Sequences MCTELPSKLQHSPPTRLCDLITHPLDAFANVIRQLVNYFKSKPNKTPVAEVSDQPSGCHSTFSGNEDVTVTTYALPSGQAATCLTLDCTPQSALTRYIKALGLIICQDFILRLLAITVLLRKLPFFHPLLVFLPRLCDFAHGHFRTCPQTGQSSTPSSRSHRGGGEKRQDKKGKQRQRGDGNGDDPSEEGNDGSKKPDGLRFPQFDPEVKLFDCPFHNTLSDSTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.59
3 0.54
4 0.48
5 0.44
6 0.43
7 0.44
8 0.39
9 0.33
10 0.31
11 0.31
12 0.31
13 0.26
14 0.21
15 0.13
16 0.14
17 0.12
18 0.13
19 0.11
20 0.11
21 0.13
22 0.15
23 0.18
24 0.19
25 0.22
26 0.3
27 0.39
28 0.44
29 0.5
30 0.55
31 0.6
32 0.58
33 0.61
34 0.58
35 0.56
36 0.53
37 0.47
38 0.43
39 0.39
40 0.37
41 0.29
42 0.27
43 0.23
44 0.21
45 0.2
46 0.16
47 0.15
48 0.17
49 0.2
50 0.21
51 0.17
52 0.17
53 0.17
54 0.17
55 0.14
56 0.13
57 0.1
58 0.08
59 0.08
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.08
73 0.08
74 0.08
75 0.09
76 0.08
77 0.09
78 0.11
79 0.12
80 0.15
81 0.17
82 0.18
83 0.17
84 0.18
85 0.17
86 0.16
87 0.16
88 0.12
89 0.1
90 0.1
91 0.09
92 0.08
93 0.07
94 0.07
95 0.05
96 0.05
97 0.05
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.08
110 0.09
111 0.12
112 0.13
113 0.15
114 0.15
115 0.17
116 0.19
117 0.19
118 0.18
119 0.14
120 0.16
121 0.14
122 0.15
123 0.13
124 0.14
125 0.13
126 0.17
127 0.28
128 0.25
129 0.27
130 0.27
131 0.29
132 0.3
133 0.31
134 0.27
135 0.19
136 0.24
137 0.24
138 0.27
139 0.28
140 0.3
141 0.3
142 0.33
143 0.34
144 0.34
145 0.37
146 0.36
147 0.35
148 0.35
149 0.43
150 0.46
151 0.52
152 0.59
153 0.61
154 0.64
155 0.71
156 0.74
157 0.71
158 0.75
159 0.76
160 0.76
161 0.78
162 0.83
163 0.82
164 0.85
165 0.86
166 0.82
167 0.76
168 0.69
169 0.62
170 0.52
171 0.42
172 0.33
173 0.25
174 0.19
175 0.13
176 0.1
177 0.11
178 0.13
179 0.14
180 0.17
181 0.17
182 0.18
183 0.21
184 0.27
185 0.3
186 0.34
187 0.43
188 0.45
189 0.46
190 0.52
191 0.52
192 0.48
193 0.48
194 0.44
195 0.39
196 0.35
197 0.36
198 0.29
199 0.3
200 0.31
201 0.3
202 0.29
203 0.27
204 0.28
205 0.26