Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SQ41

Protein Details
Accession A0A1E4SQ41    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
92-118IEFPRGRPQIRHKRDRRFKQELKLPKTBasic
NLS Segment(s)
PositionSequence
98-110RPQIRHKRDRRFK
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR040008  MRPL46  
IPR021757  Ribosomal_L46_N  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF11788  MRP-L46  
Amino Acid Sequences MRGLSGNLSRVGLVRAYSTANPTVSSTLILSRNPVITADVPKFEAQYYKYQNELWRRLMWTFPKWFYFREGTLAEQRFRQLNKDPVADNPNIEFPRGRPQIRHKRDRRFKQELKLPKTYKEADELEPAELEQAQDTITEDDLARKIVPNSRTTKADQENDLTSLERKLSRTLYLTIQNGSTWILPNFPEPSSEQVTALHTLAEEGLYKIGGEKINYFNVSNTPCHVYNNSKDNKKEYFIKSHILSGDFQPQDKSMKFLWLTKEELKTHLDKEYYQDIEHLLSEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.17
5 0.2
6 0.22
7 0.22
8 0.22
9 0.22
10 0.22
11 0.19
12 0.19
13 0.16
14 0.18
15 0.2
16 0.19
17 0.2
18 0.21
19 0.22
20 0.21
21 0.21
22 0.18
23 0.19
24 0.24
25 0.24
26 0.23
27 0.24
28 0.24
29 0.25
30 0.23
31 0.24
32 0.21
33 0.28
34 0.33
35 0.33
36 0.35
37 0.37
38 0.43
39 0.48
40 0.52
41 0.47
42 0.44
43 0.44
44 0.43
45 0.46
46 0.45
47 0.43
48 0.43
49 0.42
50 0.44
51 0.43
52 0.43
53 0.42
54 0.4
55 0.34
56 0.32
57 0.3
58 0.28
59 0.35
60 0.37
61 0.33
62 0.3
63 0.32
64 0.31
65 0.31
66 0.31
67 0.3
68 0.34
69 0.38
70 0.39
71 0.38
72 0.38
73 0.43
74 0.39
75 0.32
76 0.26
77 0.28
78 0.25
79 0.25
80 0.2
81 0.17
82 0.27
83 0.31
84 0.31
85 0.31
86 0.42
87 0.52
88 0.61
89 0.71
90 0.69
91 0.75
92 0.84
93 0.89
94 0.88
95 0.87
96 0.84
97 0.82
98 0.82
99 0.81
100 0.77
101 0.76
102 0.68
103 0.61
104 0.6
105 0.53
106 0.46
107 0.41
108 0.37
109 0.29
110 0.32
111 0.29
112 0.23
113 0.21
114 0.19
115 0.14
116 0.11
117 0.09
118 0.05
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.05
125 0.06
126 0.06
127 0.07
128 0.07
129 0.08
130 0.07
131 0.07
132 0.09
133 0.13
134 0.16
135 0.2
136 0.25
137 0.27
138 0.3
139 0.31
140 0.37
141 0.37
142 0.38
143 0.34
144 0.32
145 0.3
146 0.29
147 0.27
148 0.2
149 0.15
150 0.13
151 0.13
152 0.12
153 0.12
154 0.14
155 0.15
156 0.17
157 0.18
158 0.2
159 0.22
160 0.25
161 0.25
162 0.23
163 0.22
164 0.2
165 0.18
166 0.16
167 0.13
168 0.1
169 0.09
170 0.09
171 0.09
172 0.12
173 0.13
174 0.12
175 0.14
176 0.13
177 0.18
178 0.21
179 0.21
180 0.2
181 0.19
182 0.2
183 0.2
184 0.19
185 0.14
186 0.09
187 0.09
188 0.09
189 0.08
190 0.07
191 0.05
192 0.05
193 0.05
194 0.05
195 0.06
196 0.09
197 0.1
198 0.11
199 0.14
200 0.17
201 0.21
202 0.22
203 0.22
204 0.2
205 0.23
206 0.25
207 0.23
208 0.22
209 0.24
210 0.23
211 0.25
212 0.28
213 0.3
214 0.34
215 0.42
216 0.48
217 0.5
218 0.53
219 0.56
220 0.56
221 0.55
222 0.57
223 0.53
224 0.54
225 0.51
226 0.55
227 0.5
228 0.5
229 0.47
230 0.4
231 0.36
232 0.3
233 0.36
234 0.3
235 0.29
236 0.27
237 0.26
238 0.3
239 0.29
240 0.3
241 0.22
242 0.28
243 0.29
244 0.33
245 0.38
246 0.36
247 0.42
248 0.44
249 0.5
250 0.44
251 0.45
252 0.45
253 0.42
254 0.41
255 0.41
256 0.36
257 0.3
258 0.35
259 0.4
260 0.37
261 0.33
262 0.32
263 0.28
264 0.27