Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4U245

Protein Details
Accession A0A1E4U245    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-30SDLISREIAKKKKEKEKLISSNDEKCIHydrophilic
NLS Segment(s)
PositionSequence
13-18KKKKEK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004098  Prp18  
IPR014906  PRP4-like  
IPR036285  PRP4-like_sf  
IPR039979  PRPF18  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF02840  Prp18  
PF08799  PRP4  
Amino Acid Sequences MNFSDLISREIAKKKKEKEKLISSNDEKCINKSKVEKRSYSKAQDDDEKEKDEDTKRMKILKELNEAKRRQLQQQEEEQKKQEEQEQKENMKNSINSLKNKELMNNSITDEELANGLRSFNEPIKLFGETKIDCIKRLDSLITKRKLIEERKEQLKKELEIDFNIIPTDIRDNKSKVSIQLRSYIKYLLKEWELFISKTDIEHQSLLVETKKDLVPLLVMLRKEKIDDDIFITLSTTFQYLQQKDYQNANDSYLKLSIGNVAWPIGVINIGIHARSAHSKLTGADKKSNIMSDEITRKWLMGIKRLITFAEKKWPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.77
4 0.8
5 0.82
6 0.86
7 0.87
8 0.87
9 0.87
10 0.82
11 0.8
12 0.74
13 0.71
14 0.61
15 0.55
16 0.56
17 0.49
18 0.49
19 0.51
20 0.57
21 0.6
22 0.67
23 0.71
24 0.68
25 0.75
26 0.78
27 0.77
28 0.75
29 0.7
30 0.67
31 0.68
32 0.67
33 0.64
34 0.59
35 0.54
36 0.47
37 0.43
38 0.44
39 0.39
40 0.41
41 0.39
42 0.42
43 0.42
44 0.47
45 0.47
46 0.49
47 0.53
48 0.53
49 0.58
50 0.6
51 0.65
52 0.68
53 0.68
54 0.67
55 0.67
56 0.62
57 0.59
58 0.6
59 0.58
60 0.56
61 0.65
62 0.7
63 0.68
64 0.69
65 0.65
66 0.58
67 0.52
68 0.47
69 0.44
70 0.43
71 0.42
72 0.47
73 0.52
74 0.54
75 0.57
76 0.57
77 0.51
78 0.47
79 0.42
80 0.37
81 0.37
82 0.39
83 0.39
84 0.43
85 0.44
86 0.43
87 0.44
88 0.43
89 0.38
90 0.35
91 0.31
92 0.27
93 0.24
94 0.21
95 0.2
96 0.16
97 0.13
98 0.1
99 0.09
100 0.08
101 0.07
102 0.07
103 0.07
104 0.06
105 0.07
106 0.1
107 0.1
108 0.14
109 0.14
110 0.16
111 0.18
112 0.2
113 0.19
114 0.18
115 0.22
116 0.18
117 0.2
118 0.25
119 0.24
120 0.23
121 0.24
122 0.24
123 0.2
124 0.2
125 0.2
126 0.18
127 0.26
128 0.34
129 0.35
130 0.35
131 0.34
132 0.37
133 0.42
134 0.44
135 0.44
136 0.44
137 0.48
138 0.57
139 0.61
140 0.57
141 0.57
142 0.55
143 0.47
144 0.42
145 0.39
146 0.3
147 0.26
148 0.29
149 0.22
150 0.18
151 0.17
152 0.12
153 0.08
154 0.08
155 0.12
156 0.12
157 0.14
158 0.17
159 0.19
160 0.2
161 0.24
162 0.25
163 0.25
164 0.3
165 0.33
166 0.31
167 0.38
168 0.38
169 0.37
170 0.36
171 0.35
172 0.3
173 0.26
174 0.26
175 0.22
176 0.22
177 0.21
178 0.2
179 0.21
180 0.22
181 0.2
182 0.19
183 0.18
184 0.16
185 0.16
186 0.19
187 0.16
188 0.15
189 0.16
190 0.15
191 0.13
192 0.13
193 0.14
194 0.12
195 0.11
196 0.09
197 0.12
198 0.12
199 0.12
200 0.12
201 0.11
202 0.09
203 0.1
204 0.14
205 0.14
206 0.14
207 0.15
208 0.17
209 0.17
210 0.18
211 0.17
212 0.18
213 0.16
214 0.17
215 0.19
216 0.18
217 0.18
218 0.17
219 0.17
220 0.12
221 0.11
222 0.1
223 0.08
224 0.07
225 0.11
226 0.19
227 0.2
228 0.23
229 0.3
230 0.33
231 0.36
232 0.42
233 0.41
234 0.39
235 0.39
236 0.4
237 0.37
238 0.33
239 0.32
240 0.27
241 0.23
242 0.18
243 0.17
244 0.16
245 0.13
246 0.14
247 0.12
248 0.11
249 0.11
250 0.1
251 0.1
252 0.07
253 0.06
254 0.05
255 0.04
256 0.07
257 0.07
258 0.07
259 0.08
260 0.08
261 0.1
262 0.14
263 0.16
264 0.16
265 0.17
266 0.19
267 0.21
268 0.31
269 0.36
270 0.37
271 0.42
272 0.41
273 0.44
274 0.45
275 0.46
276 0.37
277 0.33
278 0.31
279 0.31
280 0.36
281 0.34
282 0.35
283 0.32
284 0.3
285 0.3
286 0.32
287 0.28
288 0.3
289 0.36
290 0.37
291 0.4
292 0.41
293 0.4
294 0.42
295 0.42
296 0.38