Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TYU3

Protein Details
Accession A0A1E4TYU3    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-68EKDPVKKAKKLLRKQNIEKIKLHBasic
NLS Segment(s)
PositionSequence
51-59KKAKKLLRK
Subcellular Location(s) nucl 19, cyto 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences SICKAGTPLNLKVKKTGKEPVALEDDQYPEWLWKLLDEDHQRAQLEKDPVKKAKKLLRKQNIEKIKLHNFMTKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.55
4 0.48
5 0.49
6 0.49
7 0.45
8 0.44
9 0.4
10 0.36
11 0.29
12 0.28
13 0.21
14 0.21
15 0.16
16 0.1
17 0.1
18 0.1
19 0.08
20 0.07
21 0.08
22 0.09
23 0.16
24 0.19
25 0.22
26 0.22
27 0.25
28 0.25
29 0.24
30 0.24
31 0.23
32 0.26
33 0.27
34 0.32
35 0.36
36 0.44
37 0.48
38 0.5
39 0.52
40 0.55
41 0.62
42 0.65
43 0.69
44 0.73
45 0.78
46 0.83
47 0.86
48 0.87
49 0.81
50 0.77
51 0.74
52 0.72
53 0.68
54 0.62