Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YXI4

Protein Details
Accession C7YXI4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
127-151VLRILEKGKKPKKGKVKYKIQFVGYHydrophilic
NLS Segment(s)
PositionSequence
133-143KGKKPKKGKVK
Subcellular Location(s) nucl 15, cyto 8, mito_nucl 8
Family & Domain DBs
KEGG nhe:NECHADRAFT_82540  -  
Amino Acid Sequences MPKAKAGDPQDLNTVRVDTSVESPNELRKAMDWNILCHRLFNETDNNEEPVKLIVPDGHDIAGYHIRLGIQWTMDVSSKEPAEKEWKEGLFIERDVQLVDEGKVLEYWKQLGGRDAASGIPEDFCHVLRILEKGKKPKKGKVKYKIQFVGYSAEKRQVRSWTRAQLKYNYPELLQEWEEGEKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.25
3 0.22
4 0.21
5 0.14
6 0.16
7 0.21
8 0.2
9 0.21
10 0.23
11 0.28
12 0.29
13 0.28
14 0.24
15 0.19
16 0.25
17 0.24
18 0.3
19 0.26
20 0.28
21 0.34
22 0.39
23 0.37
24 0.33
25 0.31
26 0.28
27 0.28
28 0.27
29 0.28
30 0.25
31 0.3
32 0.3
33 0.32
34 0.28
35 0.27
36 0.24
37 0.17
38 0.16
39 0.11
40 0.1
41 0.09
42 0.11
43 0.12
44 0.12
45 0.11
46 0.1
47 0.1
48 0.13
49 0.15
50 0.12
51 0.11
52 0.11
53 0.1
54 0.11
55 0.12
56 0.1
57 0.07
58 0.07
59 0.08
60 0.08
61 0.1
62 0.1
63 0.09
64 0.11
65 0.11
66 0.11
67 0.11
68 0.12
69 0.19
70 0.19
71 0.22
72 0.24
73 0.24
74 0.24
75 0.25
76 0.25
77 0.18
78 0.18
79 0.15
80 0.11
81 0.11
82 0.1
83 0.09
84 0.08
85 0.07
86 0.07
87 0.07
88 0.06
89 0.06
90 0.07
91 0.07
92 0.08
93 0.08
94 0.08
95 0.09
96 0.11
97 0.11
98 0.13
99 0.14
100 0.13
101 0.13
102 0.12
103 0.1
104 0.09
105 0.09
106 0.08
107 0.07
108 0.06
109 0.08
110 0.08
111 0.08
112 0.09
113 0.09
114 0.09
115 0.1
116 0.14
117 0.19
118 0.24
119 0.29
120 0.38
121 0.45
122 0.54
123 0.59
124 0.64
125 0.69
126 0.74
127 0.8
128 0.8
129 0.84
130 0.82
131 0.86
132 0.83
133 0.76
134 0.67
135 0.58
136 0.54
137 0.47
138 0.44
139 0.35
140 0.38
141 0.36
142 0.36
143 0.4
144 0.43
145 0.44
146 0.47
147 0.54
148 0.56
149 0.63
150 0.67
151 0.68
152 0.66
153 0.69
154 0.68
155 0.65
156 0.57
157 0.48
158 0.44
159 0.41
160 0.38
161 0.31
162 0.26
163 0.22
164 0.21