Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TMR6

Protein Details
Accession A0A1E4TMR6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
233-258GSRNDNTSAKKDKKMKKRKKFHCVILHydrophilic
NLS Segment(s)
PositionSequence
241-252AKKDKKMKKRKK
Subcellular Location(s) nucl 15.5, cyto_nucl 12.999, mito_nucl 10.166, cyto 9, cyto_mito 6.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR041841  Rsr1  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR020849  Small_GTPase_Ras-type  
Gene Ontology GO:0016020  C:membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
CDD cd04177  RSR1  
Amino Acid Sequences MRDYKLVVLGAGGVGKSSLTVQFVQGVYIESYDPTIEDSYRKQIEVDGRACDLEILDTAGVAQFTAMRELYIKSGKGFLLVYSITDDEDSLNELEAIRQQVVRIKDSENVPMVLVGNKCDLTEERRISTEKGKEIAAKWGEVPFYETSAMYKTNVQEVFVDVVRQIMLRETTSLNNTSSAAVNNINNNSNNNPKNSNINLAGVGEGQFNNKGLAVDNGDRNDGSKASKTTANGSRNDNTSAKKDKKMKKRKKFHCVIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.08
6 0.1
7 0.11
8 0.12
9 0.17
10 0.17
11 0.17
12 0.16
13 0.16
14 0.14
15 0.14
16 0.14
17 0.09
18 0.1
19 0.09
20 0.09
21 0.09
22 0.1
23 0.1
24 0.13
25 0.16
26 0.23
27 0.25
28 0.25
29 0.23
30 0.27
31 0.33
32 0.38
33 0.37
34 0.32
35 0.31
36 0.31
37 0.3
38 0.26
39 0.18
40 0.11
41 0.09
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.05
49 0.04
50 0.05
51 0.05
52 0.08
53 0.07
54 0.07
55 0.08
56 0.1
57 0.13
58 0.15
59 0.15
60 0.14
61 0.17
62 0.16
63 0.17
64 0.16
65 0.12
66 0.12
67 0.11
68 0.11
69 0.1
70 0.11
71 0.09
72 0.09
73 0.09
74 0.07
75 0.07
76 0.08
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.08
83 0.09
84 0.08
85 0.08
86 0.09
87 0.13
88 0.15
89 0.17
90 0.16
91 0.17
92 0.2
93 0.21
94 0.24
95 0.21
96 0.19
97 0.17
98 0.16
99 0.15
100 0.14
101 0.13
102 0.1
103 0.1
104 0.1
105 0.1
106 0.1
107 0.11
108 0.12
109 0.19
110 0.2
111 0.19
112 0.21
113 0.23
114 0.23
115 0.29
116 0.29
117 0.24
118 0.23
119 0.23
120 0.23
121 0.23
122 0.28
123 0.22
124 0.19
125 0.18
126 0.18
127 0.17
128 0.15
129 0.17
130 0.1
131 0.11
132 0.11
133 0.1
134 0.09
135 0.11
136 0.12
137 0.09
138 0.11
139 0.11
140 0.16
141 0.16
142 0.16
143 0.15
144 0.16
145 0.17
146 0.15
147 0.14
148 0.09
149 0.09
150 0.08
151 0.08
152 0.07
153 0.06
154 0.07
155 0.07
156 0.09
157 0.1
158 0.12
159 0.15
160 0.16
161 0.15
162 0.15
163 0.15
164 0.15
165 0.14
166 0.13
167 0.12
168 0.13
169 0.14
170 0.16
171 0.18
172 0.2
173 0.2
174 0.22
175 0.24
176 0.31
177 0.32
178 0.32
179 0.33
180 0.32
181 0.38
182 0.37
183 0.39
184 0.32
185 0.3
186 0.27
187 0.25
188 0.24
189 0.17
190 0.16
191 0.11
192 0.1
193 0.1
194 0.1
195 0.1
196 0.1
197 0.1
198 0.1
199 0.1
200 0.12
201 0.15
202 0.18
203 0.22
204 0.23
205 0.24
206 0.23
207 0.23
208 0.23
209 0.2
210 0.19
211 0.2
212 0.21
213 0.23
214 0.27
215 0.27
216 0.33
217 0.41
218 0.43
219 0.42
220 0.46
221 0.48
222 0.47
223 0.51
224 0.47
225 0.43
226 0.45
227 0.51
228 0.51
229 0.56
230 0.63
231 0.67
232 0.75
233 0.82
234 0.85
235 0.86
236 0.91
237 0.93
238 0.94