Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TTI6

Protein Details
Accession A0A1E4TTI6   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
3-41QGALKLKSKKPARLTKKQQNPKKAAPKIYKPKKNQSTITHydrophilic
NLS Segment(s)
PositionSequence
7-35KLKSKKPARLTKKQQNPKKAAPKIYKPKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGALKLKSKKPARLTKKQQNPKKAAPKIYKPKKNQSTITTSSLNKFHSSSLISNTEKLIATSNKKMNDKIDNDILKNFPINNNFNVIAKNINTNAIKGPQDEIQVKTDYTHSKEIIVLPELKALDPKEEDYTTWKHSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.85
4 0.86
5 0.89
6 0.91
7 0.9
8 0.9
9 0.88
10 0.87
11 0.87
12 0.84
13 0.83
14 0.81
15 0.83
16 0.83
17 0.86
18 0.85
19 0.82
20 0.86
21 0.85
22 0.84
23 0.8
24 0.75
25 0.72
26 0.67
27 0.64
28 0.57
29 0.49
30 0.44
31 0.41
32 0.37
33 0.3
34 0.25
35 0.21
36 0.19
37 0.2
38 0.18
39 0.19
40 0.23
41 0.22
42 0.22
43 0.22
44 0.21
45 0.19
46 0.18
47 0.17
48 0.15
49 0.18
50 0.24
51 0.27
52 0.31
53 0.32
54 0.33
55 0.33
56 0.37
57 0.35
58 0.32
59 0.35
60 0.32
61 0.32
62 0.32
63 0.29
64 0.22
65 0.2
66 0.18
67 0.14
68 0.17
69 0.19
70 0.18
71 0.21
72 0.21
73 0.21
74 0.21
75 0.19
76 0.15
77 0.14
78 0.15
79 0.12
80 0.17
81 0.17
82 0.17
83 0.18
84 0.2
85 0.2
86 0.19
87 0.2
88 0.17
89 0.22
90 0.24
91 0.24
92 0.23
93 0.24
94 0.23
95 0.22
96 0.24
97 0.24
98 0.26
99 0.29
100 0.26
101 0.26
102 0.27
103 0.29
104 0.28
105 0.26
106 0.24
107 0.19
108 0.23
109 0.22
110 0.2
111 0.22
112 0.2
113 0.21
114 0.21
115 0.24
116 0.25
117 0.26
118 0.27
119 0.28
120 0.32