Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TTA0

Protein Details
Accession A0A1E4TTA0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
123-152VQSNNIPKNFKKKSKKKTCSYCFNNGHNRAHydrophilic
NLS Segment(s)
PositionSequence
133-138KKKSKK
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 3.5
Family & Domain DBs
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MFQRPSSSEPAQELATTIESLALKVGVKTKELDDLTAKYTQRLNFVNELITNIREQLHLPESKDQDNGEIDIDDLIQYYEKRDDKEFLIVPLNKLAYKEEIIHKINKDTTTDIPTDSGTSNDVQSNNIPKNFKKKSKKKTCSYCFNNGHNRAICPIRLGNEKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.15
4 0.12
5 0.13
6 0.12
7 0.12
8 0.11
9 0.1
10 0.09
11 0.11
12 0.17
13 0.15
14 0.16
15 0.18
16 0.18
17 0.25
18 0.25
19 0.26
20 0.23
21 0.24
22 0.25
23 0.29
24 0.28
25 0.23
26 0.27
27 0.26
28 0.28
29 0.29
30 0.3
31 0.28
32 0.28
33 0.28
34 0.23
35 0.24
36 0.2
37 0.18
38 0.15
39 0.12
40 0.12
41 0.11
42 0.11
43 0.12
44 0.16
45 0.17
46 0.19
47 0.24
48 0.26
49 0.27
50 0.28
51 0.24
52 0.21
53 0.2
54 0.19
55 0.13
56 0.11
57 0.09
58 0.08
59 0.08
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.05
66 0.11
67 0.12
68 0.14
69 0.15
70 0.17
71 0.17
72 0.22
73 0.21
74 0.18
75 0.23
76 0.22
77 0.21
78 0.21
79 0.21
80 0.17
81 0.17
82 0.16
83 0.12
84 0.13
85 0.15
86 0.17
87 0.22
88 0.24
89 0.28
90 0.28
91 0.29
92 0.31
93 0.3
94 0.28
95 0.25
96 0.25
97 0.25
98 0.25
99 0.22
100 0.19
101 0.19
102 0.18
103 0.15
104 0.13
105 0.11
106 0.11
107 0.12
108 0.14
109 0.14
110 0.14
111 0.17
112 0.24
113 0.27
114 0.3
115 0.33
116 0.33
117 0.44
118 0.52
119 0.59
120 0.63
121 0.69
122 0.76
123 0.84
124 0.91
125 0.91
126 0.93
127 0.92
128 0.92
129 0.88
130 0.88
131 0.85
132 0.83
133 0.83
134 0.77
135 0.76
136 0.67
137 0.61
138 0.56
139 0.51
140 0.43
141 0.37
142 0.35
143 0.32