Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZQF7

Protein Details
Accession C7ZQF7   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22FIRYYHKARKIRPKSRNIIGGWHydrophilic
NLS Segment(s)
PositionSequence
10-13KIRP
Subcellular Location(s) mito 24, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
KEGG nhe:NECHADRAFT_56140  -  
Amino Acid Sequences FIRYYHKARKIRPKSRNIIGGWKSSGLWPVSMAKSLMNPMASKLEERPVTPPEALTPSSEATESLFCTPRSSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.83
4 0.74
5 0.73
6 0.66
7 0.6
8 0.51
9 0.43
10 0.36
11 0.29
12 0.29
13 0.19
14 0.16
15 0.13
16 0.15
17 0.15
18 0.15
19 0.15
20 0.11
21 0.11
22 0.12
23 0.12
24 0.09
25 0.09
26 0.09
27 0.11
28 0.11
29 0.12
30 0.12
31 0.17
32 0.17
33 0.18
34 0.2
35 0.2
36 0.23
37 0.22
38 0.21
39 0.18
40 0.2
41 0.2
42 0.18
43 0.18
44 0.17
45 0.17
46 0.17
47 0.15
48 0.13
49 0.14
50 0.14
51 0.16
52 0.18
53 0.18