Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TVK9

Protein Details
Accession A0A1E4TVK9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
198-226GLGYREEPKKKENKKDKVNQKKTYGNQLGHydrophilic
NLS Segment(s)
PositionSequence
205-214PKKKENKKDK
Subcellular Location(s) nucl 20, cyto_nucl 13.833, cyto 5.5, cyto_pero 3.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF12656  G-patch_2  
Amino Acid Sequences MVGFSLKQKDSSGDANKQNKKKFGSFSLKDVNSNKVKKPAVGKKGAALGYEIEEEEISKISIDTYDRIKEKKREELEKDVVIKLVPNKLLIKENSNIKKKLNDVPNLQYGLNLIEKDQEKEQEQVDQVTVTHSQASKSLEDQARESIRNQEDVVQRRENPVIINNEESESRDHDEIADEKPDYNKISVDQFGLAFLKGLGYREEPKKKENKKDKVNQKKTYGNQLGLGATKLDIDESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.66
4 0.72
5 0.75
6 0.74
7 0.72
8 0.71
9 0.67
10 0.67
11 0.69
12 0.63
13 0.64
14 0.67
15 0.62
16 0.61
17 0.57
18 0.55
19 0.53
20 0.55
21 0.52
22 0.51
23 0.51
24 0.49
25 0.57
26 0.59
27 0.59
28 0.61
29 0.58
30 0.53
31 0.58
32 0.54
33 0.44
34 0.35
35 0.27
36 0.21
37 0.2
38 0.17
39 0.11
40 0.09
41 0.09
42 0.09
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.08
50 0.1
51 0.13
52 0.19
53 0.21
54 0.25
55 0.32
56 0.38
57 0.42
58 0.5
59 0.53
60 0.57
61 0.61
62 0.66
63 0.64
64 0.61
65 0.58
66 0.49
67 0.42
68 0.32
69 0.28
70 0.22
71 0.21
72 0.17
73 0.16
74 0.17
75 0.19
76 0.24
77 0.24
78 0.25
79 0.25
80 0.33
81 0.39
82 0.44
83 0.44
84 0.4
85 0.43
86 0.43
87 0.46
88 0.45
89 0.42
90 0.41
91 0.43
92 0.45
93 0.43
94 0.39
95 0.31
96 0.24
97 0.2
98 0.16
99 0.12
100 0.09
101 0.11
102 0.12
103 0.13
104 0.14
105 0.14
106 0.15
107 0.16
108 0.17
109 0.16
110 0.15
111 0.14
112 0.14
113 0.12
114 0.1
115 0.1
116 0.1
117 0.08
118 0.09
119 0.09
120 0.09
121 0.11
122 0.13
123 0.13
124 0.13
125 0.2
126 0.2
127 0.21
128 0.22
129 0.24
130 0.25
131 0.25
132 0.25
133 0.26
134 0.25
135 0.25
136 0.24
137 0.26
138 0.3
139 0.34
140 0.39
141 0.34
142 0.34
143 0.36
144 0.37
145 0.31
146 0.26
147 0.25
148 0.25
149 0.23
150 0.24
151 0.22
152 0.22
153 0.22
154 0.22
155 0.18
156 0.16
157 0.17
158 0.16
159 0.15
160 0.14
161 0.16
162 0.17
163 0.17
164 0.17
165 0.14
166 0.15
167 0.17
168 0.19
169 0.19
170 0.18
171 0.17
172 0.16
173 0.19
174 0.2
175 0.19
176 0.18
177 0.16
178 0.16
179 0.16
180 0.14
181 0.1
182 0.09
183 0.1
184 0.09
185 0.1
186 0.11
187 0.14
188 0.21
189 0.31
190 0.4
191 0.42
192 0.49
193 0.59
194 0.66
195 0.74
196 0.78
197 0.79
198 0.81
199 0.88
200 0.91
201 0.92
202 0.93
203 0.91
204 0.88
205 0.87
206 0.82
207 0.83
208 0.78
209 0.69
210 0.61
211 0.55
212 0.48
213 0.4
214 0.35
215 0.24
216 0.17
217 0.15
218 0.12