Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4U0J6

Protein Details
Accession A0A1E4U0J6   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
101-137EEMKLDSVKRKRKLKMKKHKLRKRRKAQRSLKIKLKKBasic
NLS Segment(s)
PositionSequence
109-137KRKRKLKMKKHKLRKRRKAQRSLKIKLKK
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFALRNRLLLGSQRRFASSLTSFESSSTSRIILSAGRTTPNAPFRISSLQVQQQQRQQQKQHESFQFLYSPSSLIKNITNFEGNLLNINNNKKIEDANKVEEMKLDSVKRKRKLKMKKHKLRKRRKAQRSLKIKLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.39
4 0.38
5 0.3
6 0.27
7 0.28
8 0.28
9 0.27
10 0.26
11 0.28
12 0.22
13 0.21
14 0.18
15 0.13
16 0.12
17 0.12
18 0.12
19 0.11
20 0.13
21 0.15
22 0.15
23 0.16
24 0.17
25 0.19
26 0.23
27 0.27
28 0.26
29 0.23
30 0.22
31 0.23
32 0.27
33 0.28
34 0.25
35 0.24
36 0.29
37 0.35
38 0.38
39 0.39
40 0.4
41 0.46
42 0.51
43 0.53
44 0.53
45 0.54
46 0.6
47 0.61
48 0.63
49 0.58
50 0.55
51 0.5
52 0.46
53 0.39
54 0.3
55 0.25
56 0.17
57 0.15
58 0.11
59 0.11
60 0.09
61 0.09
62 0.11
63 0.12
64 0.13
65 0.14
66 0.14
67 0.13
68 0.14
69 0.14
70 0.12
71 0.12
72 0.12
73 0.12
74 0.15
75 0.18
76 0.2
77 0.19
78 0.19
79 0.18
80 0.21
81 0.22
82 0.27
83 0.29
84 0.29
85 0.34
86 0.35
87 0.34
88 0.33
89 0.32
90 0.27
91 0.27
92 0.26
93 0.3
94 0.38
95 0.47
96 0.54
97 0.6
98 0.66
99 0.72
100 0.79
101 0.82
102 0.85
103 0.87
104 0.89
105 0.92
106 0.94
107 0.95
108 0.96
109 0.96
110 0.96
111 0.95
112 0.95
113 0.95
114 0.95
115 0.95
116 0.94
117 0.92