Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TZM6

Protein Details
Accession A0A1E4TZM6   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-32APALPHPKIVKKHSKKFKRHHSDRYHRVSENBasic
NLS Segment(s)
PositionSequence
8-23PKIVKKHSKKFKRHHS
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAPALPHPKIVKKHSKKFKRHHSDRYHRVSENWRKQKGIDSCVRRRFRGTISQPKIGYGSNKRTRHLAPSGHKSYLVSNIKDLEVLMMHTKTYAGEIAHNVSSRKRVEILARAKALGVRITNPKARLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.87
4 0.9
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.91
13 0.86
14 0.76
15 0.71
16 0.71
17 0.7
18 0.7
19 0.7
20 0.64
21 0.58
22 0.58
23 0.62
24 0.58
25 0.54
26 0.52
27 0.51
28 0.57
29 0.66
30 0.68
31 0.61
32 0.58
33 0.54
34 0.49
35 0.51
36 0.5
37 0.52
38 0.53
39 0.58
40 0.54
41 0.51
42 0.48
43 0.38
44 0.35
45 0.3
46 0.35
47 0.39
48 0.42
49 0.42
50 0.44
51 0.44
52 0.44
53 0.43
54 0.4
55 0.37
56 0.43
57 0.46
58 0.43
59 0.42
60 0.37
61 0.33
62 0.35
63 0.33
64 0.25
65 0.22
66 0.23
67 0.23
68 0.22
69 0.21
70 0.12
71 0.08
72 0.08
73 0.09
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.09
81 0.07
82 0.09
83 0.1
84 0.13
85 0.15
86 0.17
87 0.17
88 0.17
89 0.23
90 0.22
91 0.23
92 0.22
93 0.23
94 0.28
95 0.36
96 0.42
97 0.44
98 0.44
99 0.42
100 0.4
101 0.39
102 0.35
103 0.3
104 0.24
105 0.21
106 0.28
107 0.33
108 0.38
109 0.38
110 0.4
111 0.38