Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TQU8

Protein Details
Accession A0A1E4TQU8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCINCHydrophilic
84-111VRVRSRGDRRVRAPPQRQRFNKEKRITPBasic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
87-116RSRGDRRVRAPPQRQRFNKEKRITPGAAAA
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCINCAACVPKDKAIKRVTIRNMVEAAAVRDLSEASVYEEYALPKLYNKLHYCVSCAVHSRIVRVRSRGDRRVRAPPQRQRFNKEKRITPGAAAAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.77
9 0.68
10 0.63
11 0.54
12 0.52
13 0.47
14 0.41
15 0.35
16 0.35
17 0.36
18 0.39
19 0.45
20 0.41
21 0.45
22 0.44
23 0.48
24 0.48
25 0.53
26 0.52
27 0.53
28 0.52
29 0.46
30 0.44
31 0.36
32 0.33
33 0.24
34 0.2
35 0.12
36 0.11
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.08
50 0.08
51 0.06
52 0.07
53 0.11
54 0.12
55 0.19
56 0.2
57 0.22
58 0.26
59 0.27
60 0.29
61 0.29
62 0.29
63 0.24
64 0.26
65 0.26
66 0.27
67 0.27
68 0.29
69 0.31
70 0.35
71 0.36
72 0.36
73 0.41
74 0.46
75 0.54
76 0.59
77 0.63
78 0.66
79 0.67
80 0.74
81 0.76
82 0.77
83 0.79
84 0.8
85 0.81
86 0.84
87 0.86
88 0.83
89 0.84
90 0.84
91 0.84
92 0.82
93 0.8
94 0.77
95 0.78
96 0.72
97 0.64
98 0.62