Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z7W6

Protein Details
Accession C7Z7W6    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
133-152KLQGYQRKKIWRNFMKRLEEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, nucl 9, cyto 9, pero 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003959  ATPase_AAA_core  
IPR000641  CbxX/CfxQ  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
KEGG nhe:NECHADRAFT_7997  -  
Pfam View protein in Pfam  
PF00004  AAA  
Amino Acid Sequences DLIDNKGNGLIMLLHGSPGTGKTFTAESVAEIARKPLYPVTCGDIGTEPEQVEKYLQSVFHLGKIWDCVVLLDEAEVFLEQRTLHDLKRNALVSVFLRALEYYEGILILTTNRVGTFDEAFKSRIQLALRYEKLQGYQRKKIWRNFMKRLEEIGEEDKIDFDDIELNLDDLSRYEMNGRQIRNSITTARQLAKYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.09
5 0.1
6 0.12
7 0.1
8 0.1
9 0.11
10 0.13
11 0.13
12 0.15
13 0.13
14 0.11
15 0.14
16 0.15
17 0.14
18 0.14
19 0.15
20 0.15
21 0.15
22 0.16
23 0.17
24 0.18
25 0.19
26 0.2
27 0.23
28 0.23
29 0.23
30 0.23
31 0.2
32 0.2
33 0.2
34 0.2
35 0.15
36 0.15
37 0.15
38 0.14
39 0.13
40 0.11
41 0.11
42 0.1
43 0.1
44 0.1
45 0.14
46 0.14
47 0.15
48 0.17
49 0.16
50 0.15
51 0.17
52 0.16
53 0.12
54 0.12
55 0.09
56 0.08
57 0.08
58 0.07
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.09
70 0.1
71 0.11
72 0.17
73 0.19
74 0.2
75 0.25
76 0.26
77 0.21
78 0.2
79 0.21
80 0.15
81 0.16
82 0.15
83 0.09
84 0.09
85 0.09
86 0.09
87 0.08
88 0.07
89 0.05
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.03
96 0.03
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.07
103 0.09
104 0.1
105 0.11
106 0.12
107 0.14
108 0.13
109 0.14
110 0.13
111 0.15
112 0.14
113 0.17
114 0.2
115 0.28
116 0.3
117 0.3
118 0.31
119 0.28
120 0.31
121 0.35
122 0.39
123 0.38
124 0.45
125 0.49
126 0.58
127 0.65
128 0.69
129 0.72
130 0.73
131 0.75
132 0.77
133 0.8
134 0.77
135 0.72
136 0.68
137 0.59
138 0.51
139 0.45
140 0.38
141 0.3
142 0.23
143 0.21
144 0.18
145 0.16
146 0.15
147 0.1
148 0.08
149 0.1
150 0.1
151 0.12
152 0.12
153 0.11
154 0.11
155 0.11
156 0.11
157 0.07
158 0.12
159 0.09
160 0.1
161 0.13
162 0.17
163 0.26
164 0.31
165 0.33
166 0.32
167 0.36
168 0.39
169 0.39
170 0.39
171 0.35
172 0.34
173 0.39
174 0.4
175 0.41