Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TU15

Protein Details
Accession A0A1E4TU15   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-72QNSSAHKGPPKKMKKKRKKKAEKLARIPWEBasic
NLS Segment(s)
PositionSequence
48-68HKGPPKKMKKKRKKKAEKLAR
Subcellular Location(s) mito 14.5, cyto_mito 8.5, nucl 7, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANEKKSSYSTSSSYNYTLLILVLAFFAVATCVVLHRLYLFFQNSSAHKGPPKKMKKKRKKKAEKLARIPWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.25
4 0.21
5 0.19
6 0.13
7 0.1
8 0.07
9 0.06
10 0.05
11 0.04
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.04
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.09
27 0.1
28 0.09
29 0.11
30 0.14
31 0.14
32 0.2
33 0.21
34 0.21
35 0.25
36 0.31
37 0.38
38 0.46
39 0.56
40 0.6
41 0.7
42 0.79
43 0.85
44 0.9
45 0.94
46 0.95
47 0.95
48 0.96
49 0.96
50 0.96
51 0.96
52 0.95