Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TT22

Protein Details
Accession A0A1E4TT22   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
178-205VAPAPKVEEKKKKRGLFGRKKTPKVAANHydrophilic
NLS Segment(s)
PositionSequence
184-202VEEKKKKRGLFGRKKTPKV
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MGRKSSKKSNNSGDNDLSYHEPEIKITKADEKNFKMRSQNVHDPILSAVNEAQPYEEQANVHVRSSSLSTEGQKQLKDIFGQPIVQPDISNPTRARDERPLDTIRAFEYAITGDLTYKQQLETPQLGWKLRTNMPNFQSNPYGNSQYADTNENYNVTNTNNVISFGNDNPNTEQSVYVAPAPKVEEKKKKRGLFGRKKTPKVAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.56
3 0.49
4 0.41
5 0.33
6 0.28
7 0.24
8 0.2
9 0.19
10 0.22
11 0.21
12 0.2
13 0.2
14 0.28
15 0.32
16 0.39
17 0.46
18 0.48
19 0.56
20 0.58
21 0.6
22 0.58
23 0.57
24 0.59
25 0.59
26 0.63
27 0.58
28 0.58
29 0.53
30 0.47
31 0.42
32 0.37
33 0.28
34 0.18
35 0.15
36 0.14
37 0.14
38 0.13
39 0.13
40 0.1
41 0.12
42 0.13
43 0.13
44 0.11
45 0.13
46 0.19
47 0.19
48 0.19
49 0.17
50 0.16
51 0.16
52 0.18
53 0.16
54 0.12
55 0.13
56 0.14
57 0.2
58 0.26
59 0.27
60 0.26
61 0.26
62 0.25
63 0.25
64 0.25
65 0.21
66 0.18
67 0.17
68 0.18
69 0.17
70 0.19
71 0.19
72 0.17
73 0.15
74 0.12
75 0.18
76 0.17
77 0.21
78 0.17
79 0.18
80 0.23
81 0.24
82 0.28
83 0.28
84 0.32
85 0.31
86 0.35
87 0.35
88 0.31
89 0.31
90 0.27
91 0.2
92 0.17
93 0.15
94 0.09
95 0.08
96 0.07
97 0.07
98 0.07
99 0.06
100 0.05
101 0.07
102 0.08
103 0.08
104 0.08
105 0.08
106 0.09
107 0.11
108 0.15
109 0.16
110 0.16
111 0.2
112 0.23
113 0.23
114 0.23
115 0.25
116 0.26
117 0.28
118 0.34
119 0.33
120 0.37
121 0.39
122 0.46
123 0.44
124 0.42
125 0.42
126 0.36
127 0.36
128 0.32
129 0.33
130 0.25
131 0.24
132 0.22
133 0.19
134 0.2
135 0.2
136 0.17
137 0.17
138 0.17
139 0.17
140 0.17
141 0.15
142 0.15
143 0.13
144 0.15
145 0.13
146 0.14
147 0.13
148 0.13
149 0.13
150 0.13
151 0.15
152 0.14
153 0.22
154 0.21
155 0.23
156 0.25
157 0.26
158 0.26
159 0.24
160 0.23
161 0.16
162 0.18
163 0.17
164 0.17
165 0.2
166 0.18
167 0.2
168 0.23
169 0.28
170 0.35
171 0.43
172 0.51
173 0.55
174 0.66
175 0.74
176 0.77
177 0.8
178 0.82
179 0.84
180 0.84
181 0.87
182 0.87
183 0.87
184 0.88
185 0.85