Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TS45

Protein Details
Accession A0A1E4TS45    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
169-191SEDTKIAKLNKEKKLKKWLRDQYHydrophilic
NLS Segment(s)
PositionSequence
179-184KEKKLK
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MIRAISFGKSCLTMQKRFQSSSAIKELLVTPNRYNQKNSVSNLKPNLPKSGIFFHPTPSAPTPRQTPNAFLPPTDPRKDNELYTRTTANTIPLEYMPLLNDSSKTTKNYHLTKTDITEMQKLRNEGWTRKQLKEKFKCSNLFISLATDKNAKVAQREEERLEQVKSKWSEDTKIAKLNKEKKLKKWLRDQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.5
3 0.54
4 0.54
5 0.54
6 0.54
7 0.51
8 0.51
9 0.5
10 0.41
11 0.36
12 0.35
13 0.36
14 0.35
15 0.36
16 0.33
17 0.29
18 0.36
19 0.43
20 0.44
21 0.45
22 0.43
23 0.47
24 0.5
25 0.51
26 0.53
27 0.5
28 0.54
29 0.55
30 0.57
31 0.54
32 0.49
33 0.52
34 0.44
35 0.41
36 0.38
37 0.39
38 0.35
39 0.33
40 0.31
41 0.28
42 0.29
43 0.28
44 0.29
45 0.27
46 0.31
47 0.28
48 0.31
49 0.34
50 0.35
51 0.4
52 0.37
53 0.37
54 0.36
55 0.42
56 0.39
57 0.34
58 0.33
59 0.34
60 0.39
61 0.38
62 0.34
63 0.28
64 0.33
65 0.35
66 0.34
67 0.34
68 0.3
69 0.3
70 0.31
71 0.3
72 0.25
73 0.25
74 0.23
75 0.18
76 0.16
77 0.14
78 0.12
79 0.11
80 0.12
81 0.1
82 0.1
83 0.07
84 0.07
85 0.08
86 0.07
87 0.08
88 0.09
89 0.12
90 0.14
91 0.16
92 0.18
93 0.23
94 0.3
95 0.34
96 0.37
97 0.37
98 0.38
99 0.37
100 0.37
101 0.34
102 0.3
103 0.28
104 0.3
105 0.27
106 0.29
107 0.3
108 0.29
109 0.26
110 0.31
111 0.33
112 0.32
113 0.38
114 0.44
115 0.46
116 0.5
117 0.59
118 0.59
119 0.66
120 0.7
121 0.72
122 0.7
123 0.73
124 0.73
125 0.66
126 0.65
127 0.57
128 0.49
129 0.4
130 0.36
131 0.31
132 0.27
133 0.25
134 0.21
135 0.18
136 0.19
137 0.21
138 0.18
139 0.19
140 0.21
141 0.28
142 0.33
143 0.38
144 0.39
145 0.41
146 0.45
147 0.44
148 0.43
149 0.4
150 0.34
151 0.39
152 0.37
153 0.35
154 0.37
155 0.37
156 0.39
157 0.42
158 0.49
159 0.45
160 0.51
161 0.52
162 0.53
163 0.6
164 0.66
165 0.67
166 0.7
167 0.73
168 0.73
169 0.81
170 0.83
171 0.82