Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TWY3

Protein Details
Accession A0A1E4TWY3   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
55-77AELAKQKKIKLKKKSLNNSQINSHydrophilic
NLS Segment(s)
PositionSequence
59-68KQKKIKLKKK
Subcellular Location(s) nucl 20, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010591  ATP11  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0065003  P:protein-containing complex assembly  
Pfam View protein in Pfam  
PF06644  ATP11  
Amino Acid Sequences RYKEKLAKKAKEVGAKDIDDLKEKLKDDIEETKKNLNKIDPLKELQEYEKKISAAELAKQKKIKLKKKSLNNSQINSQAESSGKFKTLDSFVDLSKISALPALELEMIWRARFAGKDNTLSAVISNEIFNRFYYNAKKNPCFVLPLPRKSQLEDHKQDEGIEIHYVQWSFVGENTTHCMITSLVEYKLHKEFARPHTTLMFHSELQKEKGVVLMNGVVDEESPITLQDAQLLLLNLQKFYGALQDSNATSRRLTLLNDFNSGNPNFSIEDLIKEAESLDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.53
4 0.5
5 0.45
6 0.4
7 0.39
8 0.34
9 0.33
10 0.32
11 0.33
12 0.3
13 0.3
14 0.3
15 0.39
16 0.43
17 0.43
18 0.46
19 0.52
20 0.52
21 0.53
22 0.52
23 0.46
24 0.47
25 0.49
26 0.53
27 0.5
28 0.49
29 0.5
30 0.48
31 0.46
32 0.44
33 0.44
34 0.4
35 0.39
36 0.4
37 0.36
38 0.34
39 0.32
40 0.31
41 0.25
42 0.27
43 0.33
44 0.33
45 0.39
46 0.42
47 0.45
48 0.48
49 0.56
50 0.59
51 0.61
52 0.68
53 0.71
54 0.79
55 0.86
56 0.89
57 0.89
58 0.88
59 0.79
60 0.73
61 0.7
62 0.61
63 0.52
64 0.42
65 0.33
66 0.25
67 0.25
68 0.22
69 0.17
70 0.16
71 0.15
72 0.15
73 0.17
74 0.18
75 0.17
76 0.19
77 0.19
78 0.18
79 0.19
80 0.19
81 0.15
82 0.14
83 0.13
84 0.09
85 0.09
86 0.09
87 0.07
88 0.07
89 0.07
90 0.06
91 0.06
92 0.06
93 0.08
94 0.08
95 0.08
96 0.08
97 0.08
98 0.09
99 0.1
100 0.13
101 0.18
102 0.2
103 0.23
104 0.23
105 0.24
106 0.23
107 0.23
108 0.19
109 0.11
110 0.09
111 0.08
112 0.07
113 0.07
114 0.08
115 0.08
116 0.08
117 0.1
118 0.1
119 0.13
120 0.2
121 0.25
122 0.29
123 0.35
124 0.36
125 0.36
126 0.38
127 0.35
128 0.32
129 0.28
130 0.33
131 0.34
132 0.38
133 0.4
134 0.42
135 0.42
136 0.4
137 0.46
138 0.43
139 0.46
140 0.46
141 0.45
142 0.43
143 0.42
144 0.41
145 0.35
146 0.27
147 0.18
148 0.14
149 0.11
150 0.09
151 0.1
152 0.1
153 0.08
154 0.08
155 0.07
156 0.06
157 0.07
158 0.09
159 0.07
160 0.09
161 0.12
162 0.13
163 0.12
164 0.12
165 0.12
166 0.1
167 0.11
168 0.12
169 0.11
170 0.1
171 0.13
172 0.14
173 0.16
174 0.19
175 0.21
176 0.19
177 0.21
178 0.29
179 0.35
180 0.43
181 0.4
182 0.4
183 0.41
184 0.42
185 0.39
186 0.35
187 0.3
188 0.22
189 0.27
190 0.29
191 0.28
192 0.29
193 0.3
194 0.25
195 0.22
196 0.24
197 0.2
198 0.17
199 0.15
200 0.14
201 0.12
202 0.12
203 0.12
204 0.09
205 0.07
206 0.08
207 0.07
208 0.05
209 0.05
210 0.05
211 0.06
212 0.07
213 0.07
214 0.09
215 0.09
216 0.09
217 0.11
218 0.11
219 0.1
220 0.13
221 0.14
222 0.11
223 0.11
224 0.11
225 0.09
226 0.09
227 0.14
228 0.12
229 0.12
230 0.14
231 0.17
232 0.18
233 0.22
234 0.24
235 0.2
236 0.18
237 0.19
238 0.2
239 0.19
240 0.21
241 0.25
242 0.31
243 0.33
244 0.36
245 0.35
246 0.33
247 0.38
248 0.36
249 0.3
250 0.22
251 0.21
252 0.18
253 0.18
254 0.22
255 0.16
256 0.18
257 0.18
258 0.2
259 0.17
260 0.17