Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TYL9

Protein Details
Accession A0A1E4TYL9   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-54QSALRFSRLRDEKRHNYVRKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18.5, cyto_nucl 16, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042226  eFR1_2_sf  
IPR005141  eRF1_2  
IPR005142  eRF1_3  
IPR029064  L30e-like  
IPR004403  Peptide_chain-rel_eRF1/aRF1  
Gene Ontology GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF03464  eRF1_2  
PF03465  eRF1_3  
Amino Acid Sequences MDGNGALFGALSGNTREILYKFTVDLPKKHGRGGQSALRFSRLRDEKRHNYVRKVAETAVQYFITADKVNVSGLVLAGSADFKNELSKSDMFDNRLQAKIVKIVDISYGGENGFNQAIELSAEALSNVKFIQEKKLITQYFDEISQDTGKFCYGIDDTLKALELGACETIIVHENLPIIRYTLKNSEGNEVIAHVDPGNPDKSWQLDKATGTDMEVVSEVSFLEWLAETYKNYGATLEFVTDRSSEGAQFVKGFGGVGALLRYKVNFEQLVDEDSDDEYYDDSDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.13
4 0.13
5 0.16
6 0.17
7 0.17
8 0.18
9 0.24
10 0.32
11 0.35
12 0.38
13 0.42
14 0.49
15 0.49
16 0.52
17 0.49
18 0.45
19 0.47
20 0.5
21 0.5
22 0.47
23 0.51
24 0.48
25 0.5
26 0.46
27 0.4
28 0.44
29 0.45
30 0.45
31 0.49
32 0.58
33 0.62
34 0.72
35 0.81
36 0.77
37 0.76
38 0.78
39 0.75
40 0.7
41 0.64
42 0.54
43 0.49
44 0.45
45 0.4
46 0.35
47 0.27
48 0.23
49 0.19
50 0.19
51 0.16
52 0.13
53 0.11
54 0.09
55 0.09
56 0.09
57 0.09
58 0.09
59 0.07
60 0.06
61 0.06
62 0.05
63 0.04
64 0.04
65 0.06
66 0.05
67 0.05
68 0.06
69 0.06
70 0.09
71 0.09
72 0.11
73 0.14
74 0.15
75 0.17
76 0.23
77 0.26
78 0.27
79 0.29
80 0.34
81 0.32
82 0.32
83 0.31
84 0.26
85 0.24
86 0.25
87 0.23
88 0.17
89 0.15
90 0.14
91 0.14
92 0.14
93 0.14
94 0.09
95 0.09
96 0.08
97 0.08
98 0.07
99 0.08
100 0.07
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.06
117 0.07
118 0.14
119 0.17
120 0.18
121 0.2
122 0.28
123 0.28
124 0.27
125 0.28
126 0.23
127 0.2
128 0.2
129 0.18
130 0.1
131 0.11
132 0.11
133 0.1
134 0.09
135 0.08
136 0.08
137 0.08
138 0.07
139 0.08
140 0.07
141 0.08
142 0.09
143 0.1
144 0.1
145 0.1
146 0.1
147 0.07
148 0.07
149 0.06
150 0.05
151 0.05
152 0.05
153 0.05
154 0.04
155 0.04
156 0.05
157 0.06
158 0.06
159 0.06
160 0.06
161 0.07
162 0.08
163 0.09
164 0.08
165 0.08
166 0.09
167 0.1
168 0.12
169 0.16
170 0.2
171 0.22
172 0.24
173 0.26
174 0.25
175 0.25
176 0.22
177 0.18
178 0.16
179 0.13
180 0.12
181 0.08
182 0.08
183 0.08
184 0.11
185 0.12
186 0.11
187 0.11
188 0.13
189 0.16
190 0.19
191 0.2
192 0.21
193 0.23
194 0.24
195 0.25
196 0.26
197 0.23
198 0.2
199 0.2
200 0.17
201 0.13
202 0.13
203 0.11
204 0.08
205 0.08
206 0.07
207 0.05
208 0.05
209 0.04
210 0.05
211 0.04
212 0.05
213 0.07
214 0.09
215 0.09
216 0.12
217 0.15
218 0.15
219 0.15
220 0.15
221 0.13
222 0.14
223 0.14
224 0.14
225 0.12
226 0.12
227 0.14
228 0.13
229 0.14
230 0.13
231 0.13
232 0.11
233 0.13
234 0.14
235 0.14
236 0.14
237 0.13
238 0.12
239 0.11
240 0.11
241 0.09
242 0.08
243 0.07
244 0.07
245 0.08
246 0.09
247 0.1
248 0.1
249 0.11
250 0.13
251 0.15
252 0.2
253 0.2
254 0.2
255 0.25
256 0.26
257 0.28
258 0.26
259 0.25
260 0.2
261 0.19
262 0.18
263 0.13
264 0.12
265 0.09