Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TR68

Protein Details
Accession A0A1E4TR68    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-38QQELARKRKEEELKIKKQQDELHydrophilic
NLS Segment(s)
PositionSequence
21-33ARKRKEEELKIKK
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012476  GLE1  
IPR038506  GLE1-like_sf  
Gene Ontology GO:0005643  C:nuclear pore  
GO:0016973  P:poly(A)+ mRNA export from nucleus  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF07817  GLE1  
Amino Acid Sequences KLEQEEEQRKKAELLKQQELARKRKEEELKIKKQQDELKRKEEEAKGNIGITNFSGIEKDFFKYKQDIIQIKETVKEPLFADKALKQATNKYKRKINPKFGQLTNSGSKLNEITNEIYQLISEVKSQLNELAYNFILNFIAKEIISQAEVEIIVKPQHSIPLAKLALNLLILFPDLKYYLIARFVKKCPYLIGYTCSIDTEEGRLRMGWKRRDNKWEEETKYNERIGGIVTLYSVMTRLSIKDVANDKPHPLPISYSWLFLSRLLNLPLDRLQNVHFFIVCNWWESCCKEFLQAYGLQARKILNLIISDWLEAVKDQKFNGCIRLKILGEDWLQHSKIESFKEMDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.59
4 0.64
5 0.67
6 0.68
7 0.69
8 0.68
9 0.66
10 0.61
11 0.65
12 0.68
13 0.71
14 0.74
15 0.76
16 0.78
17 0.81
18 0.85
19 0.8
20 0.78
21 0.77
22 0.76
23 0.77
24 0.74
25 0.73
26 0.69
27 0.68
28 0.69
29 0.67
30 0.64
31 0.58
32 0.55
33 0.48
34 0.45
35 0.44
36 0.36
37 0.29
38 0.21
39 0.19
40 0.13
41 0.12
42 0.11
43 0.1
44 0.13
45 0.13
46 0.14
47 0.16
48 0.17
49 0.21
50 0.23
51 0.25
52 0.28
53 0.35
54 0.39
55 0.4
56 0.46
57 0.46
58 0.43
59 0.44
60 0.39
61 0.36
62 0.31
63 0.29
64 0.23
65 0.26
66 0.27
67 0.24
68 0.26
69 0.23
70 0.28
71 0.28
72 0.29
73 0.23
74 0.32
75 0.42
76 0.49
77 0.54
78 0.55
79 0.61
80 0.66
81 0.76
82 0.77
83 0.77
84 0.75
85 0.77
86 0.78
87 0.72
88 0.69
89 0.6
90 0.56
91 0.48
92 0.42
93 0.33
94 0.26
95 0.25
96 0.21
97 0.2
98 0.15
99 0.14
100 0.15
101 0.15
102 0.16
103 0.15
104 0.13
105 0.12
106 0.11
107 0.1
108 0.08
109 0.08
110 0.08
111 0.09
112 0.09
113 0.1
114 0.11
115 0.11
116 0.11
117 0.11
118 0.12
119 0.11
120 0.11
121 0.1
122 0.09
123 0.08
124 0.07
125 0.07
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.06
134 0.06
135 0.05
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.07
143 0.07
144 0.09
145 0.1
146 0.1
147 0.1
148 0.17
149 0.18
150 0.17
151 0.17
152 0.15
153 0.15
154 0.14
155 0.13
156 0.05
157 0.05
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.05
165 0.06
166 0.07
167 0.13
168 0.16
169 0.18
170 0.22
171 0.24
172 0.3
173 0.3
174 0.29
175 0.25
176 0.25
177 0.26
178 0.23
179 0.24
180 0.2
181 0.2
182 0.19
183 0.18
184 0.15
185 0.12
186 0.11
187 0.12
188 0.12
189 0.12
190 0.12
191 0.12
192 0.14
193 0.2
194 0.27
195 0.33
196 0.39
197 0.47
198 0.53
199 0.62
200 0.66
201 0.68
202 0.67
203 0.68
204 0.63
205 0.61
206 0.61
207 0.57
208 0.55
209 0.48
210 0.41
211 0.32
212 0.28
213 0.22
214 0.17
215 0.12
216 0.08
217 0.07
218 0.07
219 0.07
220 0.06
221 0.05
222 0.04
223 0.05
224 0.06
225 0.06
226 0.09
227 0.13
228 0.13
229 0.19
230 0.23
231 0.26
232 0.32
233 0.33
234 0.33
235 0.32
236 0.34
237 0.3
238 0.26
239 0.25
240 0.22
241 0.29
242 0.27
243 0.25
244 0.24
245 0.24
246 0.24
247 0.23
248 0.22
249 0.16
250 0.19
251 0.19
252 0.21
253 0.19
254 0.21
255 0.22
256 0.23
257 0.21
258 0.19
259 0.2
260 0.22
261 0.23
262 0.22
263 0.18
264 0.17
265 0.17
266 0.22
267 0.2
268 0.18
269 0.17
270 0.18
271 0.21
272 0.23
273 0.25
274 0.21
275 0.22
276 0.24
277 0.24
278 0.23
279 0.25
280 0.24
281 0.25
282 0.3
283 0.3
284 0.26
285 0.27
286 0.27
287 0.23
288 0.22
289 0.2
290 0.14
291 0.14
292 0.15
293 0.17
294 0.17
295 0.16
296 0.15
297 0.14
298 0.13
299 0.12
300 0.15
301 0.14
302 0.16
303 0.17
304 0.22
305 0.26
306 0.27
307 0.36
308 0.38
309 0.35
310 0.36
311 0.42
312 0.38
313 0.36
314 0.36
315 0.33
316 0.29
317 0.31
318 0.33
319 0.32
320 0.32
321 0.3
322 0.3
323 0.28
324 0.31
325 0.32
326 0.31