Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TZT7

Protein Details
Accession A0A1E4TZT7    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-49ISDVDAKKSNKKRKNARSVKRDNPYQQPQHydrophilic
NLS Segment(s)
PositionSequence
27-40KKSNKKRKNARSVK
Subcellular Location(s) extr 11, mito 6.5, cyto_mito 5.5, nucl 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044609  FKBP2/11  
IPR046357  PPIase_dom_sf  
IPR001179  PPIase_FKBP_dom  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0061077  P:chaperone-mediated protein folding  
GO:0000413  P:protein peptidyl-prolyl isomerization  
Pfam View protein in Pfam  
PF00254  FKBP_C  
PROSITE View protein in PROSITE  
PS50059  FKBP_PPIASE  
Amino Acid Sequences MLFGKSYLFYLLLFVIVLSLISDVDAKKSNKKRKNARSVKRDNPYQQPQVIDVNSNDIKHNWAEAQNQNSDDSVQIGVTKKVGDDECARKTKDGDVLTINYTGYLADGSVFDSSKIKGRPTVFKLGAGQVLPGWDQGLRNMCIGEERKLTVPSSLAGIVGSSADSLVFKIELLSIEGYEAPKNNVEKDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.06
4 0.05
5 0.04
6 0.04
7 0.04
8 0.04
9 0.06
10 0.06
11 0.09
12 0.17
13 0.19
14 0.28
15 0.39
16 0.49
17 0.56
18 0.66
19 0.74
20 0.79
21 0.88
22 0.89
23 0.89
24 0.9
25 0.92
26 0.91
27 0.89
28 0.87
29 0.82
30 0.81
31 0.78
32 0.73
33 0.66
34 0.57
35 0.51
36 0.46
37 0.41
38 0.33
39 0.25
40 0.25
41 0.24
42 0.23
43 0.22
44 0.18
45 0.19
46 0.17
47 0.18
48 0.13
49 0.15
50 0.2
51 0.23
52 0.26
53 0.27
54 0.27
55 0.27
56 0.25
57 0.22
58 0.16
59 0.13
60 0.1
61 0.07
62 0.08
63 0.09
64 0.09
65 0.09
66 0.09
67 0.08
68 0.11
69 0.11
70 0.11
71 0.16
72 0.21
73 0.26
74 0.3
75 0.3
76 0.28
77 0.29
78 0.29
79 0.3
80 0.25
81 0.21
82 0.19
83 0.2
84 0.2
85 0.2
86 0.17
87 0.11
88 0.1
89 0.08
90 0.06
91 0.04
92 0.03
93 0.03
94 0.03
95 0.04
96 0.05
97 0.05
98 0.06
99 0.07
100 0.07
101 0.12
102 0.14
103 0.14
104 0.19
105 0.22
106 0.3
107 0.34
108 0.43
109 0.38
110 0.38
111 0.39
112 0.35
113 0.34
114 0.26
115 0.21
116 0.12
117 0.12
118 0.11
119 0.09
120 0.08
121 0.07
122 0.07
123 0.1
124 0.14
125 0.14
126 0.15
127 0.15
128 0.14
129 0.19
130 0.21
131 0.22
132 0.19
133 0.2
134 0.22
135 0.24
136 0.25
137 0.21
138 0.19
139 0.16
140 0.16
141 0.14
142 0.12
143 0.1
144 0.09
145 0.08
146 0.07
147 0.07
148 0.04
149 0.04
150 0.04
151 0.04
152 0.05
153 0.06
154 0.06
155 0.05
156 0.06
157 0.07
158 0.08
159 0.1
160 0.1
161 0.09
162 0.1
163 0.12
164 0.13
165 0.14
166 0.15
167 0.15
168 0.2
169 0.22
170 0.24