Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TQX5

Protein Details
Accession A0A1E4TQX5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
30-60GSRVRPGVRPSDRKRCHKRCQEKMSGKGVRKBasic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13.333, cyto 3
Family & Domain DBs
Amino Acid Sequences MLLFGFYAKCIACISYVASVASGTSATSFGSRVRPGVRPSDRKRCHKRCQEKMSGKGVRKDVTKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.12
5 0.11
6 0.1
7 0.09
8 0.09
9 0.07
10 0.05
11 0.04
12 0.05
13 0.05
14 0.05
15 0.06
16 0.07
17 0.1
18 0.11
19 0.12
20 0.14
21 0.18
22 0.19
23 0.28
24 0.35
25 0.42
26 0.49
27 0.59
28 0.64
29 0.71
30 0.81
31 0.81
32 0.84
33 0.85
34 0.89
35 0.89
36 0.9
37 0.91
38 0.89
39 0.87
40 0.87
41 0.84
42 0.79
43 0.75
44 0.71
45 0.65
46 0.63