Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TVV8

Protein Details
Accession A0A1E4TVV8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MGPTKCPYPNCNKILRKNKFKKQIFDDLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015877  Cdk-activating_kinase_MAT1_cen  
Pfam View protein in Pfam  
PF06391  MAT1  
Amino Acid Sequences MGPTKCPYPNCNKILRKNKFKKQIFDDLNIEKECDIRKKILEIYNKQESNFKNLNEYNKYLEEIETIIFNLSHDIDIEETTNLVKQYELMNKELINENNDKISKDYENFMKRQNLEKSFKQTRLKLQKEIEDEDAKLKKLKNLENLNNMYDEGITKNKNNNNNNNNKNVLNQMKESILKKTSARQKQLKELEQRQQERLSQLTSSFGGQQLDDINGKLQKPETPFTPFNGDRVLKLPYNEDNDYYDPIYFNLVEKNDEFRASGYNLKEFFKRSLSEAFIGLDCFICDEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.85
4 0.86
5 0.9
6 0.9
7 0.89
8 0.88
9 0.85
10 0.85
11 0.8
12 0.75
13 0.72
14 0.65
15 0.63
16 0.54
17 0.47
18 0.36
19 0.33
20 0.32
21 0.32
22 0.31
23 0.29
24 0.31
25 0.34
26 0.42
27 0.46
28 0.5
29 0.5
30 0.55
31 0.61
32 0.6
33 0.56
34 0.55
35 0.5
36 0.49
37 0.47
38 0.4
39 0.38
40 0.4
41 0.48
42 0.47
43 0.48
44 0.43
45 0.39
46 0.4
47 0.33
48 0.29
49 0.22
50 0.18
51 0.15
52 0.11
53 0.1
54 0.09
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.09
65 0.07
66 0.07
67 0.07
68 0.09
69 0.08
70 0.08
71 0.07
72 0.07
73 0.12
74 0.19
75 0.21
76 0.21
77 0.22
78 0.22
79 0.24
80 0.28
81 0.24
82 0.21
83 0.22
84 0.21
85 0.24
86 0.25
87 0.23
88 0.2
89 0.21
90 0.2
91 0.19
92 0.22
93 0.25
94 0.29
95 0.3
96 0.34
97 0.36
98 0.36
99 0.42
100 0.47
101 0.47
102 0.48
103 0.5
104 0.54
105 0.54
106 0.6
107 0.58
108 0.55
109 0.57
110 0.62
111 0.62
112 0.6
113 0.57
114 0.55
115 0.53
116 0.52
117 0.45
118 0.36
119 0.32
120 0.31
121 0.29
122 0.24
123 0.24
124 0.22
125 0.2
126 0.25
127 0.29
128 0.32
129 0.39
130 0.43
131 0.48
132 0.49
133 0.47
134 0.41
135 0.37
136 0.28
137 0.2
138 0.15
139 0.09
140 0.1
141 0.11
142 0.12
143 0.18
144 0.23
145 0.31
146 0.37
147 0.46
148 0.52
149 0.6
150 0.62
151 0.6
152 0.59
153 0.51
154 0.46
155 0.42
156 0.37
157 0.29
158 0.26
159 0.24
160 0.23
161 0.26
162 0.26
163 0.23
164 0.21
165 0.21
166 0.21
167 0.28
168 0.35
169 0.4
170 0.48
171 0.52
172 0.55
173 0.62
174 0.69
175 0.69
176 0.68
177 0.67
178 0.67
179 0.68
180 0.67
181 0.61
182 0.56
183 0.51
184 0.44
185 0.39
186 0.32
187 0.24
188 0.21
189 0.19
190 0.17
191 0.15
192 0.14
193 0.14
194 0.13
195 0.12
196 0.12
197 0.11
198 0.12
199 0.12
200 0.11
201 0.12
202 0.15
203 0.15
204 0.16
205 0.16
206 0.18
207 0.22
208 0.25
209 0.25
210 0.3
211 0.31
212 0.33
213 0.4
214 0.37
215 0.34
216 0.38
217 0.35
218 0.29
219 0.3
220 0.32
221 0.25
222 0.25
223 0.28
224 0.26
225 0.32
226 0.32
227 0.31
228 0.31
229 0.31
230 0.33
231 0.3
232 0.25
233 0.19
234 0.18
235 0.19
236 0.15
237 0.14
238 0.16
239 0.16
240 0.18
241 0.19
242 0.24
243 0.23
244 0.24
245 0.23
246 0.19
247 0.22
248 0.22
249 0.27
250 0.24
251 0.28
252 0.3
253 0.32
254 0.34
255 0.34
256 0.35
257 0.34
258 0.33
259 0.31
260 0.35
261 0.37
262 0.35
263 0.33
264 0.31
265 0.27
266 0.26
267 0.22
268 0.17
269 0.12