Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TNF0

Protein Details
Accession A0A1E4TNF0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
219-240EVGIPERKKKFIKNKITKKIKTBasic
NLS Segment(s)
PositionSequence
105-182SNRRRTKSPKQSGNGSEIKGNDKKRTPKKRESAIATPERQVVGGKVQKVTKTPRSRGDRKTPKSGVKKVKTPKLLRKS
225-240RKKKFIKNKITKKIKT
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MESRRAKIESRRRGAANRNVDVNDIVIGTPPSQGRRTRRSSASAGANAGANASASVPSSVGSGAGAGTPLKTPVRRNNKKSSSRVLTTPHSVAALQKVMSKEPASNRRRTKSPKQSGNGSEIKGNDKKRTPKKRESAIATPERQVVGGKVQKVTKTPRSRGDRKTPKSGVKKVKTPKLLRKSTIDRKAVPNFQQFSDVEEEPDLSDLDSNYEVEEDIEEVGIPERKKKFIKNKITKKIKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.74
3 0.73
4 0.66
5 0.63
6 0.57
7 0.54
8 0.46
9 0.37
10 0.27
11 0.18
12 0.14
13 0.11
14 0.11
15 0.1
16 0.12
17 0.14
18 0.17
19 0.22
20 0.29
21 0.36
22 0.45
23 0.52
24 0.56
25 0.6
26 0.62
27 0.61
28 0.6
29 0.59
30 0.53
31 0.46
32 0.39
33 0.34
34 0.28
35 0.23
36 0.16
37 0.09
38 0.07
39 0.06
40 0.05
41 0.05
42 0.06
43 0.05
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.05
53 0.04
54 0.05
55 0.05
56 0.08
57 0.11
58 0.13
59 0.19
60 0.29
61 0.4
62 0.5
63 0.57
64 0.65
65 0.73
66 0.79
67 0.79
68 0.79
69 0.75
70 0.67
71 0.64
72 0.58
73 0.52
74 0.46
75 0.41
76 0.32
77 0.25
78 0.22
79 0.19
80 0.17
81 0.15
82 0.11
83 0.13
84 0.13
85 0.13
86 0.15
87 0.15
88 0.16
89 0.22
90 0.32
91 0.34
92 0.42
93 0.48
94 0.51
95 0.58
96 0.63
97 0.66
98 0.67
99 0.72
100 0.73
101 0.69
102 0.72
103 0.67
104 0.65
105 0.57
106 0.47
107 0.39
108 0.31
109 0.32
110 0.3
111 0.3
112 0.29
113 0.31
114 0.4
115 0.49
116 0.59
117 0.63
118 0.67
119 0.73
120 0.77
121 0.78
122 0.75
123 0.72
124 0.69
125 0.67
126 0.59
127 0.52
128 0.45
129 0.38
130 0.31
131 0.24
132 0.16
133 0.17
134 0.18
135 0.19
136 0.21
137 0.22
138 0.24
139 0.28
140 0.34
141 0.37
142 0.43
143 0.46
144 0.53
145 0.6
146 0.67
147 0.71
148 0.76
149 0.77
150 0.74
151 0.79
152 0.76
153 0.76
154 0.77
155 0.79
156 0.78
157 0.74
158 0.77
159 0.76
160 0.78
161 0.78
162 0.78
163 0.79
164 0.78
165 0.79
166 0.74
167 0.73
168 0.75
169 0.75
170 0.76
171 0.71
172 0.64
173 0.65
174 0.68
175 0.67
176 0.64
177 0.62
178 0.55
179 0.5
180 0.51
181 0.43
182 0.39
183 0.37
184 0.31
185 0.24
186 0.22
187 0.21
188 0.16
189 0.17
190 0.14
191 0.08
192 0.09
193 0.08
194 0.1
195 0.1
196 0.1
197 0.09
198 0.1
199 0.09
200 0.09
201 0.09
202 0.07
203 0.07
204 0.07
205 0.06
206 0.06
207 0.09
208 0.14
209 0.14
210 0.21
211 0.25
212 0.32
213 0.38
214 0.48
215 0.56
216 0.63
217 0.73
218 0.77
219 0.85
220 0.89