Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TNW0

Protein Details
Accession A0A1E4TNW0    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
41-67RYDPTVPQPSNRRQRTRNRVLRDDNLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.833, cyto_mito 6.833, mito 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005552  Scramblase  
Gene Ontology GO:0017128  F:phospholipid scramblase activity  
Pfam View protein in Pfam  
PF03803  Scramblase  
Amino Acid Sequences MNLGFVAGTRPIAFVSVRNDSKIYLKCFSKIFTRKYSPLPRYDPTVPQPSNRRQRTRNRVLRDDNLSGSIDSYTHSPRYDYPSEFYPPNPRGTISHSDPIAELLSQPTLVIERQLELMNVFLGFEQANKYAIMDTSGAQLGYAMERDISFVKMFMRQVYRLHRPFTVDVFDIKGNLLLTIRRPFSFINSHIKSILPGIRNEETGNELIVGESIQSWHLWRRRYNLFKTELSASSIDSTNEVTGNISNTSDPAVKEDIAFEQFGYIDAPFLSFEFPVKNENGEIIGSVDRNWVGIGRELFTDTGVYIMRMDPSSFQGMEGVYSNIAGPMTLDQRAIMLGTAISIDFDYFSRHSSGNGGLIDYAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.2
3 0.28
4 0.29
5 0.31
6 0.31
7 0.31
8 0.38
9 0.41
10 0.4
11 0.38
12 0.39
13 0.41
14 0.42
15 0.44
16 0.46
17 0.49
18 0.5
19 0.53
20 0.58
21 0.6
22 0.68
23 0.75
24 0.72
25 0.72
26 0.71
27 0.64
28 0.64
29 0.64
30 0.61
31 0.57
32 0.6
33 0.53
34 0.54
35 0.6
36 0.63
37 0.69
38 0.71
39 0.74
40 0.73
41 0.82
42 0.86
43 0.88
44 0.87
45 0.86
46 0.86
47 0.84
48 0.82
49 0.78
50 0.71
51 0.61
52 0.53
53 0.46
54 0.36
55 0.29
56 0.22
57 0.14
58 0.11
59 0.13
60 0.14
61 0.15
62 0.16
63 0.17
64 0.2
65 0.27
66 0.32
67 0.31
68 0.31
69 0.33
70 0.36
71 0.35
72 0.35
73 0.36
74 0.34
75 0.36
76 0.34
77 0.31
78 0.29
79 0.34
80 0.39
81 0.35
82 0.37
83 0.33
84 0.32
85 0.31
86 0.3
87 0.24
88 0.17
89 0.12
90 0.08
91 0.08
92 0.08
93 0.07
94 0.06
95 0.07
96 0.07
97 0.08
98 0.07
99 0.08
100 0.09
101 0.1
102 0.1
103 0.09
104 0.09
105 0.08
106 0.07
107 0.07
108 0.05
109 0.05
110 0.05
111 0.05
112 0.07
113 0.07
114 0.08
115 0.08
116 0.09
117 0.08
118 0.09
119 0.09
120 0.08
121 0.08
122 0.09
123 0.09
124 0.09
125 0.08
126 0.08
127 0.07
128 0.07
129 0.06
130 0.04
131 0.04
132 0.05
133 0.06
134 0.07
135 0.08
136 0.07
137 0.08
138 0.09
139 0.11
140 0.12
141 0.14
142 0.16
143 0.17
144 0.22
145 0.28
146 0.36
147 0.36
148 0.38
149 0.35
150 0.36
151 0.36
152 0.33
153 0.29
154 0.2
155 0.18
156 0.18
157 0.17
158 0.14
159 0.12
160 0.11
161 0.08
162 0.08
163 0.08
164 0.06
165 0.09
166 0.13
167 0.14
168 0.13
169 0.15
170 0.15
171 0.18
172 0.22
173 0.23
174 0.29
175 0.29
176 0.3
177 0.29
178 0.28
179 0.25
180 0.23
181 0.25
182 0.16
183 0.15
184 0.19
185 0.2
186 0.2
187 0.2
188 0.18
189 0.15
190 0.14
191 0.13
192 0.09
193 0.08
194 0.07
195 0.07
196 0.06
197 0.04
198 0.03
199 0.04
200 0.04
201 0.04
202 0.05
203 0.12
204 0.16
205 0.21
206 0.24
207 0.3
208 0.39
209 0.47
210 0.52
211 0.53
212 0.54
213 0.51
214 0.5
215 0.48
216 0.39
217 0.34
218 0.28
219 0.21
220 0.18
221 0.18
222 0.15
223 0.12
224 0.12
225 0.1
226 0.09
227 0.09
228 0.08
229 0.07
230 0.09
231 0.09
232 0.09
233 0.08
234 0.08
235 0.1
236 0.11
237 0.11
238 0.12
239 0.14
240 0.13
241 0.14
242 0.14
243 0.15
244 0.14
245 0.14
246 0.11
247 0.1
248 0.09
249 0.09
250 0.09
251 0.07
252 0.06
253 0.06
254 0.06
255 0.06
256 0.07
257 0.07
258 0.06
259 0.07
260 0.09
261 0.1
262 0.13
263 0.13
264 0.14
265 0.13
266 0.14
267 0.14
268 0.12
269 0.12
270 0.1
271 0.11
272 0.1
273 0.1
274 0.11
275 0.1
276 0.1
277 0.1
278 0.09
279 0.09
280 0.14
281 0.15
282 0.14
283 0.15
284 0.16
285 0.16
286 0.15
287 0.14
288 0.09
289 0.1
290 0.09
291 0.08
292 0.08
293 0.09
294 0.11
295 0.11
296 0.12
297 0.12
298 0.15
299 0.19
300 0.18
301 0.17
302 0.17
303 0.16
304 0.16
305 0.16
306 0.14
307 0.1
308 0.1
309 0.1
310 0.09
311 0.09
312 0.07
313 0.07
314 0.09
315 0.12
316 0.13
317 0.13
318 0.12
319 0.13
320 0.13
321 0.13
322 0.09
323 0.07
324 0.06
325 0.06
326 0.06
327 0.06
328 0.06
329 0.06
330 0.06
331 0.06
332 0.07
333 0.11
334 0.12
335 0.14
336 0.17
337 0.17
338 0.18
339 0.2
340 0.22
341 0.23
342 0.23
343 0.21