Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TPC0

Protein Details
Accession A0A1E4TPC0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-40AAKKTAASSEPKKRNKARKETYSSYIHydrophilic
NLS Segment(s)
PositionSequence
4-33KAEKKPASKAPAAKKTAASSEPKKRNKARK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKAEKKPASKAPAAKKTAASSEPKKRNKARKETYSSYIYKVLKQTHPDTGISQKAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.65
4 0.6
5 0.56
6 0.54
7 0.5
8 0.47
9 0.46
10 0.52
11 0.6
12 0.64
13 0.7
14 0.74
15 0.8
16 0.82
17 0.85
18 0.84
19 0.84
20 0.86
21 0.82
22 0.78
23 0.74
24 0.65
25 0.57
26 0.54
27 0.44
28 0.39
29 0.38
30 0.38
31 0.35
32 0.39
33 0.39
34 0.37
35 0.38
36 0.36
37 0.33
38 0.32
39 0.3
40 0.25
41 0.22
42 0.17
43 0.16
44 0.15
45 0.14
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.09
53 0.09
54 0.08
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.11
67 0.16
68 0.18
69 0.22
70 0.23
71 0.25
72 0.26
73 0.27
74 0.29
75 0.29
76 0.33
77 0.31
78 0.33
79 0.32
80 0.31
81 0.32
82 0.27
83 0.22
84 0.17
85 0.14
86 0.1
87 0.11
88 0.11
89 0.09
90 0.09
91 0.09
92 0.1
93 0.1
94 0.1
95 0.09
96 0.1
97 0.09
98 0.1
99 0.11
100 0.13
101 0.15
102 0.15
103 0.17
104 0.17
105 0.18
106 0.19