Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZNE5

Protein Details
Accession C7ZNE5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-70WSGYAITKKIKKKRQEKKATAAEAHydrophilic
NLS Segment(s)
PositionSequence
54-64KKIKKKRQEKK
Subcellular Location(s) cyto 14, cyto_mito 12.333, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG nhe:NECHADRAFT_44490  -  
Amino Acid Sequences MPFSMADLNKRDETASKIPAPAKGFGALFGGGGYAEVVCCPLSVIFWSGYAITKKIKKKRQEKKATAAEAEEEVAVGSSDRTNHKDAEKMAEGSRASHVSPTPSPGEVSGTAPLDPALQKHPNNPRVCDPECPGYGKDFCLAHQRKGTSRPTSPGLLAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.33
4 0.37
5 0.38
6 0.42
7 0.42
8 0.37
9 0.32
10 0.29
11 0.26
12 0.22
13 0.22
14 0.17
15 0.14
16 0.11
17 0.09
18 0.06
19 0.06
20 0.06
21 0.04
22 0.03
23 0.03
24 0.04
25 0.04
26 0.04
27 0.05
28 0.04
29 0.05
30 0.06
31 0.08
32 0.08
33 0.08
34 0.09
35 0.09
36 0.12
37 0.12
38 0.13
39 0.16
40 0.23
41 0.31
42 0.4
43 0.48
44 0.55
45 0.65
46 0.74
47 0.8
48 0.84
49 0.83
50 0.84
51 0.84
52 0.78
53 0.68
54 0.58
55 0.47
56 0.36
57 0.29
58 0.19
59 0.1
60 0.06
61 0.05
62 0.05
63 0.03
64 0.03
65 0.03
66 0.05
67 0.08
68 0.11
69 0.12
70 0.14
71 0.15
72 0.18
73 0.19
74 0.23
75 0.23
76 0.22
77 0.21
78 0.23
79 0.22
80 0.2
81 0.21
82 0.16
83 0.14
84 0.14
85 0.14
86 0.14
87 0.15
88 0.17
89 0.17
90 0.16
91 0.16
92 0.15
93 0.17
94 0.14
95 0.15
96 0.15
97 0.14
98 0.13
99 0.13
100 0.13
101 0.11
102 0.11
103 0.11
104 0.14
105 0.2
106 0.22
107 0.3
108 0.4
109 0.47
110 0.51
111 0.53
112 0.55
113 0.56
114 0.57
115 0.54
116 0.49
117 0.47
118 0.45
119 0.45
120 0.38
121 0.36
122 0.34
123 0.31
124 0.3
125 0.24
126 0.24
127 0.31
128 0.34
129 0.35
130 0.4
131 0.43
132 0.44
133 0.51
134 0.59
135 0.56
136 0.57
137 0.57
138 0.54
139 0.54