Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TTL1

Protein Details
Accession A0A1E4TTL1    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-83YLLNKKNSYRVIRRQRNNEIISHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR006224  PsdUridine_synth_RluA-like_CS  
IPR006225  PsdUridine_synth_RluC/D  
IPR006145  PsdUridine_synth_RsuA/RluA  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
Pfam View protein in Pfam  
PF00849  PseudoU_synth_2  
PROSITE View protein in PROSITE  
PS01129  PSI_RLU  
CDD cd02557  PseudoU_synth_ScRIB2  
Amino Acid Sequences MSAVDSVLITPTPKPKYFFENGLRKIEPYYHLNKTFVKGRWVNKTLLEIFKAEFKSYYDLDYLLNKKNSYRVIRRQRNNEIISGLKLIDLKLNHGDLVENIQHKHEPPVKYNDKIKIIFEDEFLLVIDKPSGIPVHSTKNYYYNTIIEILKNEYNYKNLYPLHRLDKLTSGILILSKNNSKNSYYQDLFKAKQENQVIKEYIAKVDGKFPYNQFLCQDDIIQIDFHKSFNECGIKNPKKSSTLFEFLQYDHNMNQSLLRCKPLTGRTHQIRIHLKKIGFPIVNDPLYGKNGLLNEIQDLKEIDEIKFNNCIEILHSKIDNLMLDETNNCKECGIYAYKDPDINNLFICLHSQVYNFPNINLFFKSDLPEWALIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.45
4 0.49
5 0.54
6 0.56
7 0.6
8 0.62
9 0.65
10 0.63
11 0.55
12 0.52
13 0.48
14 0.42
15 0.39
16 0.41
17 0.42
18 0.45
19 0.48
20 0.48
21 0.49
22 0.52
23 0.48
24 0.51
25 0.49
26 0.52
27 0.59
28 0.59
29 0.57
30 0.52
31 0.55
32 0.51
33 0.48
34 0.43
35 0.34
36 0.31
37 0.35
38 0.34
39 0.28
40 0.24
41 0.21
42 0.24
43 0.23
44 0.25
45 0.19
46 0.18
47 0.19
48 0.25
49 0.27
50 0.31
51 0.34
52 0.32
53 0.33
54 0.38
55 0.44
56 0.46
57 0.51
58 0.54
59 0.62
60 0.72
61 0.79
62 0.83
63 0.85
64 0.86
65 0.78
66 0.7
67 0.62
68 0.53
69 0.46
70 0.37
71 0.27
72 0.19
73 0.17
74 0.15
75 0.16
76 0.14
77 0.15
78 0.17
79 0.17
80 0.16
81 0.16
82 0.16
83 0.12
84 0.17
85 0.18
86 0.17
87 0.17
88 0.18
89 0.2
90 0.2
91 0.28
92 0.29
93 0.29
94 0.32
95 0.42
96 0.46
97 0.5
98 0.56
99 0.55
100 0.55
101 0.53
102 0.49
103 0.43
104 0.41
105 0.36
106 0.3
107 0.25
108 0.19
109 0.17
110 0.16
111 0.13
112 0.09
113 0.08
114 0.08
115 0.06
116 0.05
117 0.06
118 0.07
119 0.06
120 0.09
121 0.11
122 0.19
123 0.21
124 0.23
125 0.23
126 0.3
127 0.31
128 0.3
129 0.29
130 0.22
131 0.22
132 0.23
133 0.22
134 0.16
135 0.16
136 0.17
137 0.17
138 0.17
139 0.18
140 0.15
141 0.17
142 0.19
143 0.18
144 0.19
145 0.2
146 0.23
147 0.25
148 0.28
149 0.31
150 0.34
151 0.34
152 0.31
153 0.32
154 0.3
155 0.26
156 0.22
157 0.17
158 0.12
159 0.12
160 0.11
161 0.08
162 0.09
163 0.13
164 0.15
165 0.17
166 0.19
167 0.19
168 0.22
169 0.26
170 0.3
171 0.28
172 0.28
173 0.31
174 0.33
175 0.33
176 0.33
177 0.33
178 0.27
179 0.33
180 0.36
181 0.34
182 0.33
183 0.37
184 0.34
185 0.29
186 0.32
187 0.26
188 0.21
189 0.19
190 0.17
191 0.13
192 0.19
193 0.2
194 0.19
195 0.2
196 0.2
197 0.26
198 0.25
199 0.26
200 0.21
201 0.21
202 0.21
203 0.19
204 0.19
205 0.12
206 0.12
207 0.12
208 0.11
209 0.09
210 0.1
211 0.1
212 0.09
213 0.1
214 0.1
215 0.1
216 0.15
217 0.2
218 0.17
219 0.24
220 0.35
221 0.4
222 0.43
223 0.47
224 0.46
225 0.46
226 0.47
227 0.47
228 0.43
229 0.41
230 0.38
231 0.37
232 0.34
233 0.3
234 0.33
235 0.29
236 0.23
237 0.19
238 0.2
239 0.17
240 0.16
241 0.19
242 0.18
243 0.22
244 0.22
245 0.25
246 0.24
247 0.24
248 0.31
249 0.34
250 0.36
251 0.37
252 0.46
253 0.48
254 0.56
255 0.57
256 0.59
257 0.62
258 0.61
259 0.6
260 0.57
261 0.51
262 0.48
263 0.5
264 0.49
265 0.4
266 0.35
267 0.36
268 0.37
269 0.37
270 0.32
271 0.29
272 0.24
273 0.25
274 0.24
275 0.17
276 0.14
277 0.14
278 0.16
279 0.16
280 0.14
281 0.15
282 0.17
283 0.18
284 0.16
285 0.16
286 0.15
287 0.18
288 0.19
289 0.17
290 0.19
291 0.2
292 0.21
293 0.26
294 0.25
295 0.22
296 0.21
297 0.21
298 0.18
299 0.23
300 0.23
301 0.21
302 0.22
303 0.21
304 0.22
305 0.23
306 0.2
307 0.17
308 0.17
309 0.14
310 0.14
311 0.17
312 0.19
313 0.23
314 0.24
315 0.21
316 0.19
317 0.18
318 0.18
319 0.22
320 0.24
321 0.22
322 0.26
323 0.32
324 0.35
325 0.38
326 0.37
327 0.39
328 0.37
329 0.36
330 0.3
331 0.27
332 0.25
333 0.22
334 0.24
335 0.17
336 0.16
337 0.16
338 0.16
339 0.19
340 0.21
341 0.29
342 0.27
343 0.27
344 0.3
345 0.3
346 0.33
347 0.29
348 0.3
349 0.24
350 0.25
351 0.29
352 0.25
353 0.26
354 0.27