Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TRZ9

Protein Details
Accession A0A1E4TRZ9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
183-202IDWLWVRLVRNKKNRAPLYKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11, cyto 11, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR024156  Small_GTPase_ARF  
IPR006689  Small_GTPase_ARF/SAR  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00025  Arf  
PROSITE View protein in PROSITE  
PS51417  ARF  
PS51419  RAB  
Amino Acid Sequences MFHLAKGLYDNWNKKEQYSVLILGLDNAGKTTFLEKTKSIFNPATKVTPPERILPTVGQNVSTISINPKVNLKFWDVGGQDSLRELWENYYSQCHGIVFVIDSCDKDRLLECQKVLTKIVTNDLIENIPILMLANKQDMEIETKLEVQDIKEIFNPIAEHLSARDSRVLPISAITGDGIKEAIDWLWVRLVRNKKNRAPLYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.43
4 0.39
5 0.36
6 0.34
7 0.27
8 0.28
9 0.27
10 0.21
11 0.2
12 0.15
13 0.1
14 0.09
15 0.08
16 0.07
17 0.08
18 0.1
19 0.13
20 0.16
21 0.19
22 0.2
23 0.22
24 0.3
25 0.31
26 0.34
27 0.34
28 0.34
29 0.36
30 0.37
31 0.39
32 0.33
33 0.37
34 0.34
35 0.37
36 0.36
37 0.37
38 0.38
39 0.35
40 0.36
41 0.33
42 0.34
43 0.31
44 0.3
45 0.24
46 0.21
47 0.2
48 0.19
49 0.17
50 0.14
51 0.11
52 0.16
53 0.16
54 0.16
55 0.21
56 0.21
57 0.23
58 0.25
59 0.25
60 0.21
61 0.21
62 0.27
63 0.22
64 0.21
65 0.21
66 0.19
67 0.15
68 0.14
69 0.14
70 0.08
71 0.08
72 0.07
73 0.07
74 0.09
75 0.09
76 0.1
77 0.12
78 0.12
79 0.12
80 0.12
81 0.1
82 0.09
83 0.08
84 0.08
85 0.06
86 0.06
87 0.07
88 0.06
89 0.07
90 0.08
91 0.09
92 0.08
93 0.08
94 0.09
95 0.13
96 0.18
97 0.2
98 0.19
99 0.24
100 0.26
101 0.27
102 0.27
103 0.23
104 0.2
105 0.18
106 0.21
107 0.17
108 0.16
109 0.15
110 0.15
111 0.14
112 0.12
113 0.11
114 0.08
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.06
121 0.07
122 0.07
123 0.08
124 0.08
125 0.09
126 0.13
127 0.13
128 0.13
129 0.12
130 0.13
131 0.13
132 0.14
133 0.14
134 0.1
135 0.15
136 0.14
137 0.15
138 0.16
139 0.17
140 0.16
141 0.18
142 0.18
143 0.13
144 0.15
145 0.14
146 0.12
147 0.12
148 0.16
149 0.15
150 0.16
151 0.19
152 0.18
153 0.19
154 0.22
155 0.22
156 0.18
157 0.18
158 0.18
159 0.14
160 0.13
161 0.12
162 0.09
163 0.08
164 0.08
165 0.08
166 0.06
167 0.06
168 0.06
169 0.06
170 0.08
171 0.09
172 0.1
173 0.15
174 0.17
175 0.19
176 0.27
177 0.37
178 0.44
179 0.54
180 0.63
181 0.65
182 0.74