Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TN00

Protein Details
Accession A0A1E4TN00    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
151-174GPQISEKKPRPPIPKKPINLKNSSHydrophilic
NLS Segment(s)
PositionSequence
156-166EKKPRPPIPKK
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001715  CH_dom  
IPR036872  CH_dom_sf  
IPR003096  SM22_calponin  
Gene Ontology GO:0016043  P:cellular component organization  
Pfam View protein in Pfam  
PF00307  CH  
PROSITE View protein in PROSITE  
PS50021  CH  
Amino Acid Sequences MSLNFDSSLYSLKKKDVASLDDDLRKSRMLKYENLVQAVKDWLKIYVSIDDETDLIEQLKSGEILCELINVVESKYGNNNFVKYKKSNIPFVQMENIEIFSRYCMSLGVPQDELFQTVDLFESKDPYQVLITIQSFSRALGRVFKIPKIIGPQISEKKPRPPIPKKPINLKNSSYPGWSTIEYGYMGGANQKTEKVVFGGTRHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.37
4 0.37
5 0.38
6 0.41
7 0.45
8 0.45
9 0.45
10 0.4
11 0.36
12 0.35
13 0.31
14 0.31
15 0.33
16 0.31
17 0.35
18 0.38
19 0.46
20 0.47
21 0.49
22 0.44
23 0.36
24 0.34
25 0.35
26 0.3
27 0.23
28 0.19
29 0.17
30 0.17
31 0.18
32 0.18
33 0.16
34 0.18
35 0.16
36 0.16
37 0.16
38 0.15
39 0.14
40 0.13
41 0.09
42 0.07
43 0.07
44 0.06
45 0.06
46 0.07
47 0.06
48 0.06
49 0.06
50 0.05
51 0.07
52 0.06
53 0.06
54 0.06
55 0.05
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.08
62 0.13
63 0.14
64 0.17
65 0.18
66 0.2
67 0.22
68 0.25
69 0.3
70 0.26
71 0.31
72 0.35
73 0.37
74 0.42
75 0.4
76 0.44
77 0.4
78 0.4
79 0.38
80 0.3
81 0.28
82 0.2
83 0.2
84 0.13
85 0.12
86 0.1
87 0.07
88 0.07
89 0.06
90 0.06
91 0.05
92 0.06
93 0.1
94 0.11
95 0.13
96 0.12
97 0.12
98 0.14
99 0.13
100 0.14
101 0.1
102 0.09
103 0.07
104 0.06
105 0.07
106 0.06
107 0.07
108 0.06
109 0.08
110 0.08
111 0.11
112 0.11
113 0.11
114 0.11
115 0.11
116 0.11
117 0.12
118 0.13
119 0.11
120 0.11
121 0.12
122 0.12
123 0.12
124 0.14
125 0.11
126 0.11
127 0.16
128 0.19
129 0.24
130 0.26
131 0.27
132 0.28
133 0.27
134 0.29
135 0.3
136 0.32
137 0.28
138 0.29
139 0.36
140 0.4
141 0.46
142 0.51
143 0.48
144 0.53
145 0.6
146 0.65
147 0.68
148 0.71
149 0.76
150 0.79
151 0.85
152 0.83
153 0.85
154 0.85
155 0.82
156 0.8
157 0.72
158 0.7
159 0.66
160 0.61
161 0.53
162 0.45
163 0.39
164 0.35
165 0.32
166 0.25
167 0.2
168 0.2
169 0.17
170 0.16
171 0.14
172 0.11
173 0.1
174 0.13
175 0.13
176 0.14
177 0.15
178 0.16
179 0.17
180 0.18
181 0.19
182 0.16
183 0.19
184 0.2