Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TQB5

Protein Details
Accession A0A1E4TQB5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
100-130GLYHNLTKFKKKLKRKKRKENKLMKMSKMEMBasic
NLS Segment(s)
PositionSequence
107-124KFKKKLKRKKRKENKLMK
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MIETIGKEQDFNNLKIVYLVPCGCCLDKKLIDELIKVENKKFKNNNNKEEEEINEFFGKKFLCPNCNNETLIRDVIQINPTNDNELKLLETRLQILKKLGLYHNLTKFKKKLKRKKRKENKLMKMSKMEMMEKIIAYLRSKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.29
4 0.21
5 0.21
6 0.21
7 0.16
8 0.18
9 0.2
10 0.2
11 0.2
12 0.21
13 0.24
14 0.26
15 0.27
16 0.29
17 0.32
18 0.33
19 0.32
20 0.32
21 0.32
22 0.33
23 0.32
24 0.32
25 0.33
26 0.34
27 0.43
28 0.47
29 0.49
30 0.56
31 0.65
32 0.7
33 0.7
34 0.71
35 0.64
36 0.59
37 0.53
38 0.47
39 0.38
40 0.31
41 0.25
42 0.22
43 0.2
44 0.2
45 0.17
46 0.11
47 0.17
48 0.18
49 0.24
50 0.26
51 0.32
52 0.34
53 0.37
54 0.37
55 0.31
56 0.3
57 0.25
58 0.23
59 0.18
60 0.14
61 0.12
62 0.13
63 0.15
64 0.16
65 0.14
66 0.16
67 0.16
68 0.18
69 0.18
70 0.18
71 0.15
72 0.13
73 0.13
74 0.11
75 0.12
76 0.11
77 0.11
78 0.13
79 0.17
80 0.18
81 0.18
82 0.18
83 0.2
84 0.19
85 0.23
86 0.22
87 0.24
88 0.29
89 0.34
90 0.42
91 0.48
92 0.49
93 0.52
94 0.56
95 0.6
96 0.64
97 0.68
98 0.71
99 0.73
100 0.83
101 0.87
102 0.93
103 0.95
104 0.96
105 0.96
106 0.97
107 0.96
108 0.95
109 0.92
110 0.87
111 0.83
112 0.75
113 0.68
114 0.61
115 0.53
116 0.44
117 0.39
118 0.36
119 0.28
120 0.26
121 0.25
122 0.23
123 0.25