Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TQK7

Protein Details
Accession A0A1E4TQK7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28RKRLSVSCKLCRKKKIKCDRERPICGSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences RKRLSVSCKLCRKKKIKCDRERPICGSCKKNGIPSHLCIYDDSPWISSLVKEQNYHTEIEHLKAENIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.88
4 0.89
5 0.91
6 0.92
7 0.92
8 0.89
9 0.83
10 0.79
11 0.76
12 0.71
13 0.64
14 0.56
15 0.53
16 0.47
17 0.49
18 0.46
19 0.45
20 0.42
21 0.4
22 0.41
23 0.34
24 0.33
25 0.27
26 0.26
27 0.21
28 0.2
29 0.18
30 0.14
31 0.14
32 0.14
33 0.14
34 0.12
35 0.14
36 0.19
37 0.22
38 0.23
39 0.24
40 0.31
41 0.32
42 0.33
43 0.29
44 0.29
45 0.27
46 0.28
47 0.3
48 0.24