Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TTK8

Protein Details
Accession A0A1E4TTK8   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-51VGGGKSKLKKKIRDIERLLKKDNBasic
NLS Segment(s)
PositionSequence
33-41KSKLKKKIR
95-103RKKAIRKLK
119-128AKKDIKKARK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MPPNRNNKWHNRNGAGAGSAGAVDISASVGGGKSKLKKKIRDIERLLKKDNLRSDVRVNNERALKTLKADLTNTELNLKAQKISKKYHMVRFFERKKAIRKLKQAQKNLEILENTDKSAKKDIKKARKILRHCEIDLAYVINFPKTEKYISLYPNDPNIDNKDNLDANVKKGLLETERKREIYKRDFEKLMDEGRLPIRIEDVLQGKKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.5
3 0.4
4 0.31
5 0.22
6 0.17
7 0.12
8 0.08
9 0.05
10 0.04
11 0.04
12 0.03
13 0.03
14 0.03
15 0.03
16 0.04
17 0.05
18 0.07
19 0.11
20 0.19
21 0.27
22 0.37
23 0.45
24 0.53
25 0.63
26 0.72
27 0.77
28 0.79
29 0.8
30 0.81
31 0.84
32 0.8
33 0.74
34 0.7
35 0.65
36 0.61
37 0.59
38 0.54
39 0.47
40 0.45
41 0.48
42 0.47
43 0.5
44 0.49
45 0.45
46 0.45
47 0.46
48 0.42
49 0.38
50 0.36
51 0.31
52 0.26
53 0.28
54 0.26
55 0.23
56 0.24
57 0.23
58 0.23
59 0.24
60 0.22
61 0.2
62 0.17
63 0.16
64 0.18
65 0.17
66 0.15
67 0.18
68 0.22
69 0.26
70 0.29
71 0.36
72 0.43
73 0.48
74 0.55
75 0.58
76 0.58
77 0.6
78 0.66
79 0.64
80 0.62
81 0.62
82 0.58
83 0.58
84 0.64
85 0.66
86 0.64
87 0.68
88 0.71
89 0.74
90 0.78
91 0.77
92 0.72
93 0.67
94 0.62
95 0.53
96 0.45
97 0.36
98 0.29
99 0.27
100 0.22
101 0.19
102 0.19
103 0.19
104 0.18
105 0.26
106 0.3
107 0.29
108 0.37
109 0.47
110 0.54
111 0.61
112 0.69
113 0.7
114 0.74
115 0.76
116 0.76
117 0.76
118 0.7
119 0.62
120 0.58
121 0.49
122 0.41
123 0.35
124 0.26
125 0.17
126 0.14
127 0.14
128 0.1
129 0.09
130 0.09
131 0.11
132 0.12
133 0.13
134 0.12
135 0.17
136 0.22
137 0.25
138 0.28
139 0.28
140 0.29
141 0.33
142 0.33
143 0.3
144 0.28
145 0.31
146 0.31
147 0.29
148 0.28
149 0.27
150 0.26
151 0.26
152 0.3
153 0.26
154 0.24
155 0.28
156 0.27
157 0.23
158 0.23
159 0.25
160 0.23
161 0.31
162 0.35
163 0.4
164 0.46
165 0.47
166 0.5
167 0.53
168 0.58
169 0.58
170 0.61
171 0.59
172 0.6
173 0.61
174 0.59
175 0.57
176 0.52
177 0.47
178 0.4
179 0.33
180 0.3
181 0.3
182 0.33
183 0.29
184 0.24
185 0.22
186 0.2
187 0.2
188 0.22
189 0.26