Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TQ00

Protein Details
Accession A0A1E4TQ00   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-102PKDLRAKKTRAIRRRLTKFERNQITEHydrophilic
NLS Segment(s)
PositionSequence
77-94PKDLRAKKTRAIRRRLTK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAAVKAYELRTKSKAQLEEQLVDLKKELAALKVQKLTKPSLPKINTVRKNIARVLTIINLQQRENVRAFYSGKKYLPKDLRAKKTRAIRRRLTKFERNQITEKQRKAQITFPQRRYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.51
4 0.5
5 0.48
6 0.45
7 0.45
8 0.38
9 0.34
10 0.3
11 0.22
12 0.17
13 0.18
14 0.17
15 0.11
16 0.17
17 0.2
18 0.23
19 0.29
20 0.31
21 0.3
22 0.32
23 0.35
24 0.35
25 0.39
26 0.4
27 0.43
28 0.43
29 0.48
30 0.54
31 0.61
32 0.62
33 0.59
34 0.63
35 0.56
36 0.58
37 0.54
38 0.47
39 0.38
40 0.31
41 0.28
42 0.21
43 0.18
44 0.17
45 0.17
46 0.16
47 0.15
48 0.17
49 0.16
50 0.18
51 0.18
52 0.17
53 0.15
54 0.17
55 0.19
56 0.2
57 0.24
58 0.25
59 0.27
60 0.32
61 0.33
62 0.4
63 0.44
64 0.47
65 0.52
66 0.58
67 0.66
68 0.67
69 0.69
70 0.66
71 0.7
72 0.72
73 0.71
74 0.71
75 0.7
76 0.74
77 0.8
78 0.84
79 0.82
80 0.82
81 0.82
82 0.84
83 0.83
84 0.77
85 0.73
86 0.73
87 0.75
88 0.73
89 0.69
90 0.67
91 0.64
92 0.64
93 0.62
94 0.6
95 0.6
96 0.63
97 0.68
98 0.65
99 0.68
100 0.65