Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TRT5

Protein Details
Accession A0A1E4TRT5   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
205-236PILKKNYNSTRKKSSNFKNIKNIKKKIYKNQNHydrophilic
NLS Segment(s)
PositionSequence
225-229KNIKK
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013734  TF_Nrm1/Whi5  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08528  Whi5  
Amino Acid Sequences MTTAVPVPAPVPASSSRMALAPISNSKLNSNSNVKSNGHLKPFASSTPFLKRSITLDMNLLPSLKRRLSNSGKEMGMGKHVLQNFNYSTSLTAAAMSAAAYPSPIPTPTIGENLENLERSEKLEKLEKKLNHAELLKTRLRLAYYKIKSNQVDTPISKIVDTSREFTKTPLIKRAQTLEMLLASSTPLINSMQYPLPTSIPPHHPILKKNYNSTRKKSSNFKNIKNIKKKIYKNQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.19
4 0.18
5 0.19
6 0.17
7 0.16
8 0.17
9 0.2
10 0.23
11 0.25
12 0.25
13 0.27
14 0.3
15 0.31
16 0.33
17 0.36
18 0.35
19 0.38
20 0.43
21 0.41
22 0.42
23 0.45
24 0.45
25 0.42
26 0.42
27 0.37
28 0.35
29 0.36
30 0.34
31 0.31
32 0.27
33 0.27
34 0.34
35 0.36
36 0.33
37 0.32
38 0.31
39 0.3
40 0.36
41 0.33
42 0.25
43 0.25
44 0.25
45 0.26
46 0.25
47 0.22
48 0.15
49 0.16
50 0.2
51 0.21
52 0.22
53 0.23
54 0.32
55 0.39
56 0.47
57 0.48
58 0.49
59 0.46
60 0.44
61 0.43
62 0.34
63 0.29
64 0.22
65 0.18
66 0.17
67 0.18
68 0.19
69 0.17
70 0.2
71 0.18
72 0.2
73 0.19
74 0.15
75 0.14
76 0.14
77 0.14
78 0.1
79 0.09
80 0.07
81 0.06
82 0.06
83 0.05
84 0.05
85 0.04
86 0.03
87 0.03
88 0.03
89 0.04
90 0.05
91 0.05
92 0.06
93 0.06
94 0.09
95 0.1
96 0.12
97 0.12
98 0.12
99 0.12
100 0.13
101 0.14
102 0.12
103 0.11
104 0.09
105 0.09
106 0.11
107 0.12
108 0.11
109 0.12
110 0.2
111 0.22
112 0.26
113 0.34
114 0.33
115 0.37
116 0.42
117 0.42
118 0.39
119 0.38
120 0.36
121 0.32
122 0.37
123 0.33
124 0.28
125 0.27
126 0.24
127 0.24
128 0.22
129 0.24
130 0.28
131 0.29
132 0.36
133 0.38
134 0.44
135 0.43
136 0.45
137 0.44
138 0.38
139 0.4
140 0.33
141 0.34
142 0.3
143 0.29
144 0.26
145 0.22
146 0.19
147 0.2
148 0.21
149 0.2
150 0.21
151 0.23
152 0.24
153 0.24
154 0.31
155 0.31
156 0.33
157 0.39
158 0.4
159 0.4
160 0.43
161 0.47
162 0.41
163 0.36
164 0.33
165 0.26
166 0.22
167 0.19
168 0.16
169 0.11
170 0.09
171 0.08
172 0.07
173 0.05
174 0.06
175 0.06
176 0.07
177 0.08
178 0.1
179 0.13
180 0.14
181 0.17
182 0.17
183 0.19
184 0.19
185 0.22
186 0.26
187 0.29
188 0.31
189 0.34
190 0.4
191 0.43
192 0.48
193 0.55
194 0.58
195 0.58
196 0.65
197 0.7
198 0.72
199 0.77
200 0.79
201 0.79
202 0.78
203 0.79
204 0.8
205 0.8
206 0.81
207 0.82
208 0.83
209 0.83
210 0.84
211 0.88
212 0.88
213 0.86
214 0.85
215 0.86
216 0.86