Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TQB9

Protein Details
Accession A0A1E4TQB9    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MNPQHSQIKKRKRLPISCTTCRKRKIKCDRQKPLCGACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito_nucl 13.166, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MNPQHSQIKKRKRLPISCTTCRKRKIKCDRQKPLCGACKKNNVPVHLCIYDDSPWISSIVKEENLKNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.82
4 0.81
5 0.83
6 0.8
7 0.78
8 0.78
9 0.78
10 0.75
11 0.77
12 0.79
13 0.79
14 0.82
15 0.85
16 0.88
17 0.89
18 0.87
19 0.82
20 0.78
21 0.75
22 0.71
23 0.66
24 0.62
25 0.64
26 0.59
27 0.62
28 0.58
29 0.54
30 0.51
31 0.48
32 0.47
33 0.37
34 0.35
35 0.28
36 0.26
37 0.23
38 0.21
39 0.18
40 0.13
41 0.13
42 0.13
43 0.13
44 0.11
45 0.13
46 0.16
47 0.2
48 0.23