Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4U1G6

Protein Details
Accession A0A1E4U1G6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-125LYNKKLIRSRKLSRRARRRNNNNGATDDHydrophilic
NLS Segment(s)
PositionSequence
102-116KLIRSRKLSRRARRR
Subcellular Location(s) nucl 7, plas 6, E.R. 5, mito_nucl 5, mito 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006976  VanZ-like  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04892  VanZ  
Amino Acid Sequences MRIRKPVLGSFSNIELSSYDKALHFVVFMVLTALFYFLVDVRDLKKLKILTFVICTVIASTTSEFLQDFLTGSRRKFDPMDILANMIGSAVGLIVADLYNKKLIRSRKLSRRARRRNNNNGATDDYDIEAQPAERDYDEDGDEEMLIQEQLSAQVTNHSNDSNDSKKQENPKSKSDLIILKNLPPEPIKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.2
3 0.21
4 0.19
5 0.17
6 0.16
7 0.13
8 0.15
9 0.15
10 0.15
11 0.11
12 0.1
13 0.11
14 0.09
15 0.09
16 0.08
17 0.07
18 0.07
19 0.07
20 0.07
21 0.05
22 0.05
23 0.06
24 0.06
25 0.07
26 0.07
27 0.09
28 0.1
29 0.17
30 0.18
31 0.18
32 0.23
33 0.24
34 0.25
35 0.3
36 0.3
37 0.26
38 0.28
39 0.28
40 0.25
41 0.22
42 0.21
43 0.14
44 0.13
45 0.1
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.07
57 0.13
58 0.14
59 0.15
60 0.18
61 0.17
62 0.2
63 0.2
64 0.21
65 0.21
66 0.22
67 0.26
68 0.22
69 0.23
70 0.2
71 0.19
72 0.17
73 0.11
74 0.07
75 0.03
76 0.03
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.03
84 0.03
85 0.04
86 0.07
87 0.07
88 0.08
89 0.13
90 0.19
91 0.26
92 0.35
93 0.44
94 0.51
95 0.61
96 0.71
97 0.77
98 0.83
99 0.86
100 0.88
101 0.91
102 0.91
103 0.92
104 0.92
105 0.89
106 0.81
107 0.73
108 0.65
109 0.56
110 0.47
111 0.36
112 0.26
113 0.19
114 0.16
115 0.13
116 0.09
117 0.07
118 0.07
119 0.07
120 0.07
121 0.06
122 0.08
123 0.09
124 0.11
125 0.11
126 0.11
127 0.11
128 0.1
129 0.1
130 0.09
131 0.08
132 0.06
133 0.05
134 0.05
135 0.04
136 0.04
137 0.05
138 0.06
139 0.07
140 0.06
141 0.13
142 0.15
143 0.16
144 0.18
145 0.17
146 0.17
147 0.2
148 0.26
149 0.26
150 0.29
151 0.31
152 0.33
153 0.39
154 0.48
155 0.56
156 0.6
157 0.61
158 0.63
159 0.68
160 0.67
161 0.64
162 0.6
163 0.58
164 0.51
165 0.54
166 0.48
167 0.44
168 0.47
169 0.44
170 0.41