Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4U0A2

Protein Details
Accession A0A1E4U0A2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-40AMAGGKKSKKKWSKGKVKDKAQHLVHydrophilic
NLS Segment(s)
PositionSequence
11-35AKAAAAMAGGKKSKKKWSKGKVKDK
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKIQQSKAAKAAAAMAGGKKSKKKWSKGKVKDKAQHLVILDQEKYDRIMKEVPSYRYVSVSVLVDRLKVNGSLARVALRHLEREGIIKPVLKSSKQKIYTRATASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.2
4 0.14
5 0.16
6 0.19
7 0.22
8 0.25
9 0.3
10 0.39
11 0.47
12 0.56
13 0.63
14 0.71
15 0.79
16 0.84
17 0.9
18 0.9
19 0.91
20 0.88
21 0.83
22 0.79
23 0.7
24 0.62
25 0.52
26 0.43
27 0.36
28 0.31
29 0.25
30 0.18
31 0.17
32 0.14
33 0.15
34 0.16
35 0.13
36 0.12
37 0.15
38 0.16
39 0.22
40 0.27
41 0.28
42 0.28
43 0.3
44 0.28
45 0.26
46 0.26
47 0.19
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.11
54 0.1
55 0.11
56 0.1
57 0.09
58 0.1
59 0.1
60 0.11
61 0.12
62 0.12
63 0.13
64 0.12
65 0.13
66 0.18
67 0.17
68 0.18
69 0.17
70 0.19
71 0.18
72 0.21
73 0.21
74 0.18
75 0.19
76 0.2
77 0.2
78 0.26
79 0.3
80 0.32
81 0.39
82 0.43
83 0.52
84 0.57
85 0.62
86 0.62
87 0.66
88 0.7