Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TW90

Protein Details
Accession A0A1E4TW90   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
112-131IMKNSPTKWARKYSNRREVEHydrophilic
NLS Segment(s)
Subcellular Location(s) pero 9, nucl 8, cyto 6, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017384  NADH_Ub_cplx-1_asu_su-1  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0070469  C:respirasome  
Amino Acid Sequences MIPFEGLIPYGFMFAFFVLGGATMNSMVISEISRRPNANFIGEGEDPNVKHYIKNRYNTDQWDKYFALRDLRLTGSLRGQSDNAIADEAFKTNSIQPYNNTKRPWVLRKHIIMKNSPTKWARKYSNRREVESQELKDQYIRDMNGQTDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.06
4 0.06
5 0.05
6 0.05
7 0.05
8 0.04
9 0.05
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.05
17 0.08
18 0.13
19 0.17
20 0.2
21 0.21
22 0.22
23 0.27
24 0.28
25 0.28
26 0.24
27 0.22
28 0.25
29 0.24
30 0.23
31 0.19
32 0.2
33 0.17
34 0.18
35 0.19
36 0.14
37 0.15
38 0.21
39 0.3
40 0.34
41 0.42
42 0.46
43 0.49
44 0.53
45 0.58
46 0.6
47 0.55
48 0.49
49 0.47
50 0.42
51 0.37
52 0.37
53 0.32
54 0.28
55 0.22
56 0.22
57 0.19
58 0.19
59 0.2
60 0.17
61 0.16
62 0.14
63 0.16
64 0.16
65 0.15
66 0.14
67 0.13
68 0.12
69 0.12
70 0.1
71 0.08
72 0.07
73 0.07
74 0.08
75 0.07
76 0.07
77 0.06
78 0.07
79 0.1
80 0.14
81 0.15
82 0.16
83 0.19
84 0.3
85 0.38
86 0.43
87 0.42
88 0.4
89 0.44
90 0.51
91 0.56
92 0.53
93 0.54
94 0.56
95 0.63
96 0.7
97 0.67
98 0.64
99 0.61
100 0.61
101 0.63
102 0.56
103 0.56
104 0.51
105 0.54
106 0.56
107 0.59
108 0.6
109 0.62
110 0.71
111 0.74
112 0.81
113 0.79
114 0.79
115 0.76
116 0.72
117 0.71
118 0.69
119 0.61
120 0.58
121 0.54
122 0.49
123 0.45
124 0.4
125 0.35
126 0.33
127 0.31
128 0.28
129 0.3