Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TN67

Protein Details
Accession A0A1E4TN67   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-57IGTSSKSKIKSKIKSKSNSKSKSDSKNKIKIKNKNIGKKEKEKGKEKRRLSTEHydrophilic
NLS Segment(s)
PositionSequence
10-53KSKIKSKIKSKSNSKSKSDSKNKIKIKNKNIGKKEKEKGKEKRR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045103  RNF5/RNF185-like  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0046872  F:metal ion binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0016567  P:protein ubiquitination  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF13923  zf-C3HC4_2  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MAPVIGTSSKSKIKSKIKSKSNSKSKSDSKNKIKIKNKNIGKKEKEKGKEKRRLSTELNKSSDDNGNNGNERLKRKRPLVIEDSDDENEEVEVVVKNKKPKIQPLENVSDSVTLSDNDEDDQNESSGDEEIIVLSEKRVGVLNESGVHTFFKKTTCPVCLDSPEHPVVTPCGHMYCQECILKALATSKNVVSNVSGLCAVCRKSVQYNSLVPLKIRISAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.69
3 0.74
4 0.77
5 0.83
6 0.88
7 0.89
8 0.89
9 0.88
10 0.84
11 0.83
12 0.82
13 0.83
14 0.83
15 0.83
16 0.82
17 0.84
18 0.86
19 0.86
20 0.87
21 0.86
22 0.85
23 0.85
24 0.84
25 0.84
26 0.85
27 0.86
28 0.85
29 0.84
30 0.84
31 0.83
32 0.82
33 0.82
34 0.84
35 0.84
36 0.85
37 0.82
38 0.82
39 0.78
40 0.76
41 0.73
42 0.73
43 0.72
44 0.71
45 0.68
46 0.6
47 0.55
48 0.52
49 0.49
50 0.4
51 0.31
52 0.26
53 0.25
54 0.25
55 0.25
56 0.26
57 0.25
58 0.31
59 0.37
60 0.42
61 0.45
62 0.48
63 0.53
64 0.54
65 0.56
66 0.56
67 0.51
68 0.47
69 0.42
70 0.42
71 0.35
72 0.31
73 0.23
74 0.17
75 0.14
76 0.1
77 0.08
78 0.05
79 0.05
80 0.06
81 0.1
82 0.12
83 0.17
84 0.2
85 0.25
86 0.27
87 0.35
88 0.43
89 0.47
90 0.51
91 0.52
92 0.56
93 0.52
94 0.49
95 0.41
96 0.33
97 0.25
98 0.19
99 0.14
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.07
106 0.07
107 0.07
108 0.08
109 0.07
110 0.07
111 0.07
112 0.07
113 0.06
114 0.06
115 0.05
116 0.04
117 0.04
118 0.04
119 0.05
120 0.04
121 0.04
122 0.06
123 0.05
124 0.06
125 0.08
126 0.08
127 0.1
128 0.11
129 0.12
130 0.12
131 0.14
132 0.14
133 0.13
134 0.13
135 0.12
136 0.12
137 0.12
138 0.12
139 0.13
140 0.17
141 0.21
142 0.23
143 0.26
144 0.28
145 0.31
146 0.34
147 0.36
148 0.34
149 0.35
150 0.34
151 0.3
152 0.27
153 0.24
154 0.21
155 0.19
156 0.18
157 0.13
158 0.13
159 0.14
160 0.16
161 0.18
162 0.18
163 0.23
164 0.23
165 0.22
166 0.21
167 0.22
168 0.2
169 0.18
170 0.22
171 0.2
172 0.2
173 0.22
174 0.22
175 0.26
176 0.26
177 0.25
178 0.2
179 0.2
180 0.18
181 0.18
182 0.17
183 0.13
184 0.14
185 0.17
186 0.18
187 0.17
188 0.19
189 0.21
190 0.28
191 0.35
192 0.38
193 0.39
194 0.42
195 0.45
196 0.5
197 0.48
198 0.4
199 0.4
200 0.36