Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3PBM0

Protein Details
Accession A0A1E3PBM0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-72RLRTDNKIRYNAKRRHWRRTKLNIHydrophilic
NLS Segment(s)
PositionSequence
60-67AKRRHWRR
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences MPVCTHQDRESLEKSYHHNPTRESQKSFKTKQKLAKAANQNRPLPQWIRLRTDNKIRYNAKRRHWRRTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.47
4 0.46
5 0.45
6 0.44
7 0.51
8 0.58
9 0.58
10 0.55
11 0.51
12 0.54
13 0.6
14 0.64
15 0.63
16 0.61
17 0.62
18 0.66
19 0.7
20 0.69
21 0.64
22 0.66
23 0.68
24 0.7
25 0.72
26 0.7
27 0.63
28 0.56
29 0.54
30 0.5
31 0.41
32 0.39
33 0.39
34 0.37
35 0.42
36 0.47
37 0.49
38 0.52
39 0.6
40 0.61
41 0.58
42 0.63
43 0.63
44 0.67
45 0.73
46 0.76
47 0.76
48 0.78
49 0.81
50 0.83
51 0.87
52 0.87