Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P8Y1

Protein Details
Accession A0A1E3P8Y1   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
151-170AETEKKMKARQLERKRRREEBasic
NLS Segment(s)
PositionSequence
155-170KKMKARQLERKRRREE
Subcellular Location(s) nucl 18, cyto 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019180  Oxidoreductase-like_N  
IPR039251  OXLD1  
Pfam View protein in Pfam  
PF09791  Oxidored-like  
Amino Acid Sequences TNPLTFEGNTTLVGTPEERMMNVFGGRIKGDARQSSSRREIGEPRMIAGVLVPHKPTEPNNCCMSGCVNCVWEQYNDDLKDWRRLRNEAAIKLNQTDRIWPSDFNPPLAALEMKNSKPGAQHARSVVPELNQDLEDKEDWENVPVSFRVFAETEKKMKARQLERKRRREE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.15
4 0.14
5 0.13
6 0.14
7 0.14
8 0.15
9 0.15
10 0.15
11 0.13
12 0.15
13 0.15
14 0.15
15 0.14
16 0.17
17 0.22
18 0.25
19 0.29
20 0.37
21 0.39
22 0.46
23 0.5
24 0.49
25 0.46
26 0.46
27 0.46
28 0.44
29 0.49
30 0.41
31 0.37
32 0.34
33 0.31
34 0.27
35 0.21
36 0.18
37 0.13
38 0.14
39 0.13
40 0.13
41 0.14
42 0.16
43 0.19
44 0.26
45 0.28
46 0.31
47 0.33
48 0.34
49 0.33
50 0.32
51 0.31
52 0.22
53 0.2
54 0.16
55 0.15
56 0.13
57 0.14
58 0.15
59 0.13
60 0.13
61 0.14
62 0.19
63 0.18
64 0.19
65 0.22
66 0.22
67 0.3
68 0.31
69 0.33
70 0.3
71 0.32
72 0.33
73 0.38
74 0.41
75 0.37
76 0.39
77 0.36
78 0.33
79 0.33
80 0.32
81 0.27
82 0.22
83 0.21
84 0.18
85 0.2
86 0.21
87 0.19
88 0.2
89 0.27
90 0.27
91 0.25
92 0.24
93 0.2
94 0.19
95 0.19
96 0.18
97 0.09
98 0.13
99 0.16
100 0.16
101 0.19
102 0.19
103 0.19
104 0.2
105 0.26
106 0.31
107 0.29
108 0.33
109 0.33
110 0.36
111 0.36
112 0.37
113 0.32
114 0.24
115 0.24
116 0.21
117 0.2
118 0.16
119 0.17
120 0.14
121 0.15
122 0.14
123 0.14
124 0.14
125 0.14
126 0.14
127 0.16
128 0.16
129 0.14
130 0.16
131 0.15
132 0.15
133 0.14
134 0.14
135 0.15
136 0.15
137 0.18
138 0.21
139 0.26
140 0.29
141 0.34
142 0.36
143 0.37
144 0.42
145 0.48
146 0.53
147 0.58
148 0.65
149 0.71
150 0.8